Glyma05g30643 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g30643

Feature Type:	gene_model
Chromosome:	Gm05
Start:	35975261
stop:	35976306
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g30643

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G67785	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 30 Blast hits to 30 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 30; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr1:25416100-25416984 REVERSE LENGTH=63	SoyBase	E_val: 7.00E-27	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005747	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_C6SYT6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYT6_SOYBN	SoyBase	E_val: 2.00E-37	ISS

Expression Patterns of Glyma05g30643

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g30643 not represented in the dataset	Glyma05g30643 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g30643

Paralog	Evidence	Comments
Glyma08g13840	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g30643 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g172800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g30643

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g30643

Limit To All Plant Sequences

>Glyma05g30643.1   sequence type=CDS   gene model=Glyma05g30643   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAAGTGGCGACGTACTTCGCGATGACGCTAGGAGCCTTCGTGTTCTGGCAGTCCATGGACAAGCTCCATGTCTGGATCGCTCTCCGTCAAGACGAAAAGAAAGAGAGGTTGGAGAAGGAAGCCGAGATCAGAAGGGTTAGAGAAGAATTATTGCAGCAGCAGGCCAGTCAGAAGGATTCTCTTTCTTGA

Predicted protein sequences of Glyma05g30643

Limit To All Plant Sequences

>Glyma05g30643.1   sequence type=predicted peptide   gene model=Glyma05g30643   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKVATYFAMTLGAFVFWQSMDKLHVWIALRQDEKKERLEKEAEIRRVREELLQQQASQKDSLS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain