SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g30591): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g30591): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g30591

Feature Type:gene_model
Chromosome:Gm05
Start:35950473
stop:35952224
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G13180AT Annotation by Michelle Graham. TAIR10: Actin-like ATPase superfamily protein | chr1:4495394-4498204 FORWARD LENGTH=427 SoyBaseE_val: 2.00E-106ISS
GO:0000902GO-bp Annotation by Michelle Graham. GO Biological Process: cell morphogenesis SoyBaseN/AISS
GO:0007015GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament organization SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0030833GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of actin filament polymerization SoyBaseN/AISS
GO:0045010GO-bp Annotation by Michelle Graham. GO Biological Process: actin nucleation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005856GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoskeleton SoyBaseN/AISS
GO:0005885GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Arp2/3 protein complex SoyBaseN/AISS
GO:0003779GO-mf Annotation by Michelle Graham. GO Molecular Function: actin binding SoyBaseN/AISS
GO:0005200GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR11937Panther ACTIN JGI ISS
PTHR11937:SF31Panther ACTIN RELATED PROTEIN 1 JGI ISS
PF00022PFAM Actin JGI ISS
UniRef100_B9RMS2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9RMS2_RICCO SoyBaseE_val: 6.00E-106ISS
UniRef100_C6TG99UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TG99_SOYBN SoyBaseE_val: 1.00E-141ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g30591 not represented in the dataset

Glyma05g30591 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g172200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g30591.1   sequence type=CDS   gene model=Glyma05g30591   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCCATCTACTTTTCGTCCAGCTGTAGTCATCGATAATGGCTCCGGGTATACGAAGATGGGGTTTGCTGGTAATGTTGAGCCGTGTTTTATTGCTCCGACAGTTGTTGCAGTTAATGAGTCGTTTCTGAATCAATCGAGGGGCTCTTCTAAAGGCAATTGGGTGGCCCAGCACAATGCTGGAATTATGGCGGATCTTGATTTCTTCATTGGGGATGAAGCACTTACCAAGTCTCGATCTAGTAGCAGTTACAATCTCAGCTACCCGATTCAGCATGGCCAGGTTGAGAATTGGGATGCCATGGAGCGCTTCTGGCAGCAGTGCATTTTCAATTATTTGAGCTGTGATCCAGAGGATCACTATTTCCTCTTGACCGAGAGTCCATTGACTCCGCCTGAGAGTCGCGAGTATACTGGGGAGATCATGTTTGAGACTTTTAATGTGCCTGGACTTTACATTGGTGTGAATTCTGTGCTTGCTCTTGCAGCTGGATACACAACATCCAAGGTTGGTAATCGTTACACCCGAAAAAGATTGGGAATTATGTTGAATATAGAATTGGAATTGGATGATTAA

>Glyma05g30591.1   sequence type=predicted peptide   gene model=Glyma05g30591   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPSTFRPAVVIDNGSGYTKMGFAGNVEPCFIAPTVVAVNESFLNQSRGSSKGNWVAQHNAGIMADLDFFIGDEALTKSRSSSSYNLSYPIQHGQVENWDAMERFWQQCIFNYLSCDPEDHYFLLTESPLTPPESREYTGEIMFETFNVPGLYIGVNSVLALAAGYTTSKVGNRYTRKRLGIMLNIELELDD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo