Glyma05g30241 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g30241): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g30241): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g30241

Feature Type:	gene_model
Chromosome:	Gm05
Start:	35636219
stop:	35637360
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g30241

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G09790	AT	Annotation by Michelle Graham. TAIR10: ARABIDOPSIS TRITHORAX-RELATED PROTEIN 5 \| chr5:3039204-3040970 REVERSE LENGTH=352	SoyBase	E_val: 4.00E-52	ISS
GO:0006275	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009294	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA mediated transformation	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0051726	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle	SoyBase	N/A	ISS
GO:0070734	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone H3-K27 methylation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0046976	GO-mf	Annotation by Michelle Graham. GO Molecular Function: histone methyltransferase activity (H3-K27 specific)	SoyBase	N/A	ISS
UniRef100_B9HEJ6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: SET domain protein n=1 Tax=Populus trichocarpa RepID=B9HEJ6_POPTR	SoyBase	E_val: 9.00E-52	ISS
UniRef100_I1JY36	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JY36_SOYBN	SoyBase	E_val: 8.00E-66	ISS

Expression Patterns of Glyma05g30241

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g30241 not represented in the dataset	Glyma05g30241 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g30241 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g168700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g30241

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g30241

Limit To All Plant Sequences

>Glyma05g30241.1   sequence type=CDS   gene model=Glyma05g30241   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAATTGGGTATTGATACTCATGACCATTATAATCGCTATAAAGCCTCTCTCCCTTGGAAATATCACTAGTATTGGAGCTCCTAGATCTGTGAATCAAGCCACACTAAAAACTGGTGGCATGAAGATTCTTTCCAAGGAAGACATGGAGACCATAGAACACTGCATTGCTATCTCTAAAAGAGGTGAATTCCCTCCCTTTATGGTTGTTTATGATTCATGTGAAGGTTATACTGTTGAGGCTGATGACCTTATCAAGGATATGGCAATTACTGCTGAATACATTGGCGATGTGGATTACCTTGACAACCAGGAACGTGATGATTCTGACAGTATTATGTCCCTTCTTAGAGCAGAAAGTTCTCAAAGTGTTGTTAGCTGTGCTGATAAACGAAGGTTTTTTTTTGTGGTTGCTACTCATGACATTTCTAAGGGAGAGAGGCTTTATTATGATCATAATGGTCATGAGTATCAATACCCGACTCATCATTTTCTCTGA

Predicted protein sequences of Glyma05g30241

Limit To All Plant Sequences

>Glyma05g30241.1   sequence type=predicted peptide   gene model=Glyma05g30241   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMNWVLILMTIIIAIKPLSLGNITSIGAPRSVNQATLKTGGMKILSKEDMETIEHCIAISKRGEFPPFMVVYDSCEGYTVEADDLIKDMAITAEYIGDVDYLDNQERDDSDSIMSLLRAESSQSVVSCADKRRFFFVVATHDISKGERLYYDHNGHEYQYPTHHFL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain