SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g29810

Feature Type:gene_model
Chromosome:Gm05
Start:35299913
stop:35301058
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g29810
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29380AT Annotation by Michelle Graham. TAIR10: Carbohydrate-binding X8 domain superfamily protein | chr1:10284209-10285671 FORWARD LENGTH=315 SoyBaseE_val: 1.00E-33ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR16631Panther GLUCAN 1,3-BETA-GLUCOSIDASE-RELATED JGI ISS
PF07983PFAM X8 domain JGI ISS
UniRef100_G7K3C6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glucan endo-1,3-beta-glucosidase-like protein n=1 Tax=Medicago truncatula RepID=G7K3C6_MEDTR SoyBaseE_val: 4.00E-38ISS
UniRef100_UPI000233A0C9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A0C9 related cluster n=1 Tax=unknown RepID=UPI000233A0C9 SoyBaseE_val: 4.00E-97ISS

Expression Patterns of Glyma05g29810
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g29810 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g165000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g29810
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g29810
>Glyma05g29810.2   sequence type=CDS   gene model=Glyma05g29810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GATGTCCCTATCGTGGGAAACCCTAACACTCCTCCTCAAACACCTGACACATCAGGGCAAAACCCCACGGCCCCAAACACAAATCCAACAACCCCAACCACAACACCAACATCATCAGGTGGTCAATGGTGTGTTGCTAAACAGGGAGCTTCGGACGCTGATCTACAGGTTGCTCTTGACTATGCTTGTGGGATTGGACGTGCAGACTGCTCAGCAATACAACCAGGAGCAAGCTGCTATAATCCGAACACTGTCCGTGATCATGCTTCCTATGCATTCAATAACTACTACCAGAAGAATCCAATACCTAACAGCTGTGTATTTGGAGGAACAGCATCCCTTACAAACAATGATCCAACACCAACAGTTATCAGCCCACCAAGTGCACCAACAGTTGTCAGCCCACCGAGTCCGCCATTATTTGTCAGTCCACCAACTCCACCAGGCACGCTAAATCCCGGTGGCGGATCAAATGTCTTTGGTTCAGAACCAAAAGGAAACCCCAACACAGCCACATCTGCATTTTATTCCCTGCTTCTGTTGTTCACATGTGGCCTGTTGGCTTCCCTTCAACTAGCAAATTACATCTAA
Predicted protein sequences of Glyma05g29810
>Glyma05g29810.2   sequence type=predicted peptide   gene model=Glyma05g29810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DVPIVGNPNTPPQTPDTSGQNPTAPNTNPTTPTTTPTSSGGQWCVAKQGASDADLQVALDYACGIGRADCSAIQPGASCYNPNTVRDHASYAFNNYYQKNPIPNSCVFGGTASLTNNDPTPTVISPPSAPTVVSPPSPPLFVSPPTPPGTLNPGGGSNVFGSEPKGNPNTATSAFYSLLLLFTCGLLASLQLANYI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo