Report for Sequence Feature Glyma05g29751
Feature Type: gene_model
Chromosome: Gm05
Start: 35262686
stop: 35263691
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g29751
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_G7L813 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Pre-mRNA-processing factor n=1 Tax=Medicago truncatula RepID=G7L813_MEDTR
SoyBase E_val: 2.00E-12 ISS
UniRef100_I1KSK4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KSK4_SOYBN
SoyBase E_val: 4.00E-16 ISS
Expression Patterns of Glyma05g29751
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma05g29751
Paralog Evidence Comments
Glyma08g12860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g29751 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma05g29751
Coding sequences of Glyma05g29751
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g29751.1 sequence type=CDS gene model=Glyma05g29751 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCAGATACAGAACACTTCATCTCAGTCTCAAACACCAGCCAATACCACATCACATGTATTACAACATGCAATGCAAGGTAATGAGCAATATGGATATATGCAGAATGGCCAAGAATATAATCATTTATGGCAATACTATTACTACCAGCAGCAGCAACAGCTGCAGCTACAACAACATTATATTCAATTACAGCAGCAATCGTTCCAGCAGGGACAGTCACAACAACAACATAGCCAGCTGGAACCTCTTCAACCACAACAGCTCCAACAACAGGTTCTACAGCAGCAACCTCTGCAACAAGAACACCCTGTACACCTTATGCAGCAACAGCAGCCATCAACAAGGAGCAGCAGTCATCCCATAGCAGACCAAGGGCAGGCAATATTAACATCGCAGGGCCACGGAGCAATATTATCCCAACAATCAGACAAACTTGGGTCGATTTCTTCTCTAGTTGTGTATCATCCTCAAGAGAAATCAACCAAAGAAGACTGA
Predicted protein sequences of Glyma05g29751
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g29751.1 sequence type=predicted peptide gene model=Glyma05g29751 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MQIQNTSSQSQTPANTTSHVLQHAMQGNEQYGYMQNGQEYNHLWQYYYYQQQQQLQLQQHYIQLQQQSFQQGQSQQQHSQLEPLQPQQLQQQVLQQQPLQQEHPVHLMQQQQPSTRSSSHPIADQGQAILTSQGHGAILSQQSDKLGSISSLVVYHPQEKSTKED*