SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g29090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g29090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g29090

Feature Type:gene_model
Chromosome:Gm05
Start:34760928
stop:34763043
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g29090
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29160AT Annotation by Michelle Graham. TAIR10: Dof-type zinc finger DNA-binding family protein | chr1:10183797-10184324 REVERSE LENGTH=175 SoyBaseE_val: 2.00E-51ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PF02701PFAM Dof domain, zinc finger JGI ISS
UniRef100_C6T5G7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5G7_SOYBN SoyBaseE_val: 1.00E-120ISS
UniRef100_F6M8H3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dof-domain transcription factor protein n=1 Tax=Platycodon grandiflorus RepID=F6M8H3_9ASTR SoyBaseE_val: 9.00E-55ISS

Expression Patterns of Glyma05g29090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g29090 not represented in the dataset
Glyma05g29090 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g29090
ParalogEvidenceComments
Glyma08g12230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g29090 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g158200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g29090
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g29090
>Glyma05g29090.1   sequence type=CDS   gene model=Glyma05g29090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAAGCACAAAGTGGCCAAGCTAGTGAAGGGATTAAACTGTTTGGAACAACGATTACGTTGCATGGAAGAGAAAGAAAAGAAGATAGAAATGATAGTGAAGATGGGACAGAGGAGATAAAGAGACCTGATAAGATCATACCATGCCCAAGATGCAAGAGCATGGAAACCAAGTTTTGCTACTTCAATAACTACAACGTTAATCAGCCCAGACATTTCTGCAAGGGATGCCAGAGATACTGGACGGCTGGTGGGGCCCTTCGCAACGTGCCAGTAGGAGCTGGCAGGCGAAAGGTCAAACCGCAGTTTGGTCAGGAGGAGAGGTTGGCTTTGGATGAATGGCATGTTGCCGCCGTGGCTCATGGTGATTTCCGGCAGCTTTTTCCATCTAAAAGACGGAGGATGAGCTCAGCTCAGCATGAAAGTCAAAGAAAGTTTGTTATCATCCACGAAATCACAGAACATCCAAATCAGATAGAAACAAAGGAGGCTTGA
Predicted protein sequences of Glyma05g29090
>Glyma05g29090.1   sequence type=predicted peptide   gene model=Glyma05g29090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEAQSGQASEGIKLFGTTITLHGRERKEDRNDSEDGTEEIKRPDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKVKPQFGQEERLALDEWHVAAVAHGDFRQLFPSKRRRMSSAQHESQRKFVIIHEITEHPNQIETKEA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo