SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g28960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g28960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g28960

Feature Type:gene_model
Chromosome:Gm05
Start:34684163
stop:34684654
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g28960
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75390AT Annotation by Michelle Graham. TAIR10: basic leucine-zipper 44 | chr1:28292224-28292745 FORWARD LENGTH=173 SoyBaseE_val: 2.00E-40ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009410GO-bp Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046982GO-mf Annotation by Michelle Graham. GO Molecular Function: protein heterodimerization activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PTHR22952Panther CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED JGI ISS
PTHR22952:SF60Panther SUBFAMILY NOT NAMED JGI ISS
PF00170PFAM bZIP transcription factor JGI ISS
UniRef100_Q0GPG2UniRef Annotation by Michelle Graham. Most informative UniRef hit: BZIP transcription factor bZIP111 n=1 Tax=Glycine max RepID=Q0GPG2_SOYBN SoyBaseE_val: 3.00E-115ISS
UniRef100_Q0GPG2UniRef Annotation by Michelle Graham. Best UniRef hit: BZIP transcription factor bZIP111 n=1 Tax=Glycine max RepID=Q0GPG2_SOYBN SoyBaseE_val: 3.00E-115ISS

Expression Patterns of Glyma05g28960
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g28960 not represented in the dataset
Glyma05g28960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g28960 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g157000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g28960
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g28960
>Glyma05g28960.1   sequence type=CDS   gene model=Glyma05g28960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTCCTGGTGGAAGTGGAACCTATTCATCTGGTTCCAGTTCTCTTCAAAACTCTGGTTCTGAAGGAGACAGAGACATCATGGAACAGAGGAAGAGGAAGAGAATGTTGTCCAATAGGGAATCGGCACGTAGATCGAGGATAAGGAAACAGCAGCACCTGGAAGGTCTGAGTGCCCAATTGGATCAGCTTAAAAAGGAGAACGCACAAATCAACACAAACATAAGCATCACGACGCAGATGTACCTCAACGTGGAAGCTGAGAACGCGATTCTGAGGGCTCAAATGGGGGAACTGAGCAACAGATTGAACTCTCTGAACGAAATGATAAGTTTCATTAACTCCACCAACAACAACTGCTTGATGATGTTCGATGAGGCACAGGAGACGACCACTCAGTTGTTCAATGATTGTGGCTTCATGGATTATGCTTGGAATGGAATACCAATCATGGCTTCCGCTGACAATGAAATGTTGATCATGTATTGA
Predicted protein sequences of Glyma05g28960
>Glyma05g28960.1   sequence type=predicted peptide   gene model=Glyma05g28960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASPGGSGTYSSGSSSLQNSGSEGDRDIMEQRKRKRMLSNRESARRSRIRKQQHLEGLSAQLDQLKKENAQINTNISITTQMYLNVEAENAILRAQMGELSNRLNSLNEMISFINSTNNNCLMMFDEAQETTTQLFNDCGFMDYAWNGIPIMASADNEMLIMY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo