Glyma05g28860 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g28860

Feature Type:	gene_model
Chromosome:	Gm05
Start:	34595689
stop:	34596962
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g28860

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G30845	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 120 Blast hits to 120 proteins in 67 species: Archae - 0; Bacteria - 0; Metazoa - 35; Fungi - 37; Plants - 23; Viruses - 0; Other Eukaryotes - 25 (source: NCBI BLink). \| chr1:10979856-10980427 FORWARD LENGTH=118	SoyBase	E_val: 5.00E-21	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF00892	PFAM	EamA-like transporter family	JGI		ISS
UniRef100_Q9SY30	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: T17H7.16 n=2 Tax=Arabidopsis thaliana RepID=Q9SY30_ARATH	SoyBase	E_val: 2.00E-17	ISS
UniRef100_UPI0002339F45	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339F45 related cluster n=1 Tax=unknown RepID=UPI0002339F45	SoyBase	E_val: 2.00E-40	ISS

Expression Patterns of Glyma05g28860

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g28860

Paralog	Evidence	Comments
Glyma08g12010	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g28860 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma05g28860

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g28860

Limit To All Plant Sequences

>Glyma05g28860.2   sequence type=CDS   gene model=Glyma05g28860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGAGGCAACAGAAAAGGGGAGGCAACAGAAAAGGGTACGCGTGGCCAGTATCTGCTGGATTCAACGCCGCTCGTGCAGCCATTTCAGGCAACTGTCACCAATTTCGCTACCAATTTCATCTCTTCCGGTTTAGCCGGTTTCGTCTTCTTTCACGAATCGCTCTCTTTCCAGTGGTTTGCAGGTGCCATACTTATAATAATTGGTGTAGTAATACTTAGTAACTCAAGTTTTGAGAAGAAGGTTAGCACTGATTAG

Predicted protein sequences of Glyma05g28860

Limit To All Plant Sequences

>Glyma05g28860.2   sequence type=predicted peptide   gene model=Glyma05g28860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGGNRKGEATEKGTRGQYLLDSTPLVQPFQATVTNFATNFISSGLAGFVFFHESLSFQWFAGAILIIIGVVILSNSSFEKKVSTD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain