Glyma05g27940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g27940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g27940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g27940

Feature Type:	gene_model
Chromosome:	Gm05
Start:	33793872
stop:	33796837
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g27940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G67430	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L22p/L17e family protein \| chr1:25262209-25263627 FORWARD LENGTH=175	SoyBase	E_val: 3.00E-116	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0015934	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3353	KOG	60S ribosomal protein L22	JGI		ISS
PTHR11593	Panther	60S RIBOSOMAL PROTEIN L17	JGI		ISS
PF00237	PFAM	Ribosomal protein L22p/L17e	JGI		ISS
UniRef100_C6SWG9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWG9_SOYBN	SoyBase	E_val: 2.00E-131	ISS
UniRef100_G7JC06	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L17 n=1 Tax=Medicago truncatula RepID=G7JC06_MEDTR	SoyBase	E_val: 2.00E-123	ISS

Expression Patterns of Glyma05g27940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g27940 not represented in the dataset	Glyma05g27940 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g27940

Paralog	Evidence	Comments
Glyma08g10910	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g27940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g146800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g27940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g27940

Limit To All Plant Sequences

>Glyma05g27940.1   sequence type=CDS   gene model=Glyma05g27940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAGTACTCAAGGGAGCCTGACAATCCAACCAAGTCTTGCAAGGCTAGAGGCGCCGACCTTAGGGTTCATTTTAAGAACACTAGGGAAACTGCCTTTGCAATCAGGAAGTTGCCCTTGGTTAAAGCTAAAAGGTACTTGGAAGATGTTCTTGCGCACAAGCAGGCCATTCCGTTCAGACGTTTCTGTCGTGGTGTTGGAAGGACAGCTCAAGCAAAGAATAGACACTCTAATGGCCAAGGAAGGTGGCCTGTCAAGTCAGCAAAATTCATCCTTGATTTGCTCAAAAATGCTGAGAGCAATGCTGAAGTGAAAGGTTTGGATGTTGATGCGCTTTACATTTCTCATATCCAAGTCAATCAAGCACAGAAGCAAAGACGCCGAACATACCGAGCCCATGGAAGAATCAATCCTTATATGTCATCTCCGTGCCACATAGAGTTGATATTATCTGAAAAAGAAGAACCTGTGAAGAAGGAGCCCGAGACTAAGTTAGCAACAAGCAAGAAATCCCAAGCTCTTCGAAGTGGCACTTCATCTTAG

Predicted protein sequences of Glyma05g27940

Limit To All Plant Sequences

>Glyma05g27940.1   sequence type=predicted peptide   gene model=Glyma05g27940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKYSREPDNPTKSCKARGADLRVHFKNTRETAFAIRKLPLVKAKRYLEDVLAHKQAIPFRRFCRGVGRTAQAKNRHSNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEPETKLATSKKSQALRSGTSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain