SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g27800

Feature Type:gene_model
Chromosome:Gm05
Start:33668123
stop:33669741
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g27800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G67600AT Annotation by Michelle Graham. TAIR10: Acid phosphatase/vanadium-dependent haloperoxidase-related protein | chr1:25336701-25337455 REVERSE LENGTH=163 SoyBaseE_val: 3.00E-59ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0019375GO-bp Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02681PFAM Divergent PAP2 family JGI ISS
UniRef100_G7JC22UniRef Annotation by Michelle Graham. Most informative UniRef hit: Acid phosphatase/vanadium-dependent haloperoxidase-like protein n=1 Tax=Medicago truncatula RepID=G7JC22_MEDTR SoyBaseE_val: 1.00E-56ISS
UniRef100_UPI0002339DD9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339DD9 related cluster n=1 Tax=unknown RepID=UPI0002339DD9 SoyBaseE_val: 2.00E-89ISS

Expression Patterns of Glyma05g27800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g27800
ParalogEvidenceComments
Glyma08g10790 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g27800 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g145600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g27800
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g27800
>Glyma05g27800.2   sequence type=CDS   gene model=Glyma05g27800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATTCTAAAACCTCATCAATCTCTTCCAATTACCCAATCATTTCTGCCATTGTTGCTTTTGCAATTGCTCAATCCATCAAGTTCTTCACCACTTGGTTGATATGCAAGTTTAAGGAAAGAAGATGGAATCTGAAGCAATTAGTTGGGTCTGGTGGAATGCCATCATCTCATTCAGCAACTGTCACTGCTCTTGCAGCTGCCATTGGATTGCAGGAAGGCTTTGGAGGACCTCTTTTTGCCACTGCCTTGGTTTTTGCTTGTATTGTGATGTATGATGCTACTGGTCTAAGATTGCAAGCAGGACCCCAAGCAGAGGTTTTAAACCAAATTGTGTATGAACTTCCTGCTAAGCATCCTCTGACCTCAGTCATTGTCGGTGGGATACTTGGACTTTTAACACCTATTGGCCTTTTAAGACCTGTGACTAAGAATTGA
Predicted protein sequences of Glyma05g27800
>Glyma05g27800.2   sequence type=predicted peptide   gene model=Glyma05g27800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHSKTSSISSNYPIISAIVAFAIAQSIKFFTTWLICKFKERRWNLKQLVGSGGMPSSHSATVTALAAAIGLQEGFGGPLFATALVFACIVMYDATGLRLQAGPQAEVLNQIVYELPAKHPLTSVIVGGILGLLTPIGLLRPVTKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo