SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g27270): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g27270): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g27270

Feature Type:gene_model
Chromosome:Gm05
Start:33180568
stop:33181673
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g27270
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31190AT Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF647 | chr2:13291458-13293681 REVERSE LENGTH=433 SoyBaseE_val: 1.00E-68ISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
PTHR12770Panther FAMILY NOT NAMED JGI ISS
PTHR12770:SF5Panther gb def: putative protein [arabidopsis thaliana] JGI ISS
PF04884PFAM Protein of unknown function, DUF647 JGI ISS
UniRef100_I1K3F3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1K3F3_SOYBN SoyBaseE_val: 1.00E-89ISS
UniRef100_Q01J52UniRef Annotation by Michelle Graham. Most informative UniRef hit: OSIGBa0145M07.5 protein n=2 Tax=Oryza sativa RepID=Q01J52_ORYSA SoyBaseE_val: 2.00E-59ISS

Expression Patterns of Glyma05g27270
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g27270 not represented in the dataset
Glyma05g27270 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g27270 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g141100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g27270
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g27270
>Glyma05g27270.3   sequence type=CDS   gene model=Glyma05g27270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACATGTAGGGAAGCTAATATGTAGCAATTGGGGAGGTACAATGGATTCTGAACCTAAACGATGGAGACTATTAGCTGATGCGCTCTATGATATAGGCACTGGCTTGGAAGTGCTTTCTCCACGGTGCCCACATCTTTTTCTTGAAATGGCAGGCTTAGGAAATTTTGCAAAGGGGATGTCAGTTGTTGCAGCAAGAGCAACAAGGTTGCCTATATATTCTTCATTTGCCAAAGAAGGAAATCTAAGTGACCTATTAGCTAAAGGAGAGGCATTTTCAACTCTCTTTAATGTTATTGGAATTGGAGTTGGGATTCAATTAGCATCTACCATCTGTGCATCAATGCAGGGAAAGGTAAAGTGTTTTTATTTGTTTGTTCCTGGGTTGTAG
Predicted protein sequences of Glyma05g27270
>Glyma05g27270.3   sequence type=predicted peptide   gene model=Glyma05g27270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQHVGKLICSNWGGTMDSEPKRWRLLADALYDIGTGLEVLSPRCPHLFLEMAGLGNFAKGMSVVAARATRLPIYSSFAKEGNLSDLLAKGEAFSTLFNVIGIGVGIQLASTICASMQGKVKCFYLFVPGL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo