Glyma05g26470 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g26470

Feature Type:	gene_model
Chromosome:	Gm05
Start:	32428302
stop:	32430004
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g26470

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G47278	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; Has 37 Blast hits to 37 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 36; Viruses - 0; Other Eukaryotes - 1 (source: NCBI BLink). \| chr1:17331383-17331726 FORWARD LENGTH=80	SoyBase	E_val: 2.00E-33	ISS
UniRef100_C6T5H6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5H6_SOYBN	SoyBase	E_val: 4.00E-52	ISS

Expression Patterns of Glyma05g26470

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g26470

Paralog	Evidence	Comments
Glyma08g09391	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g26470 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g134100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g26470

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g26470

Limit To All Plant Sequences

>Glyma05g26470.1   sequence type=CDS   gene model=Glyma05g26470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCGGAAAGCTGGTACGCTTTTCATCAACCCCAAGAGATTTGGTAATCTTCAAAAACCTTGCATGAAGGAAATGGCATTGTTTCTCAGTTGTATGGCTGCAAACCATAGCGATACCGACGCTTGTGCTCGCCAGAAGGAGCTATTAAATGTCTGTATTGATGCTCAGAGTAAAAAGAACAGAAAGTCTTGGGGGAGTATCAATTATCAACTGCAGAGGCTTAACCGAGGAAGGAAGTAG

Predicted protein sequences of Glyma05g26470

Limit To All Plant Sequences

>Glyma05g26470.1   sequence type=predicted peptide   gene model=Glyma05g26470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRKAGTLFINPKRFGNLQKPCMKEMALFLSCMAANHSDTDACARQKELLNVCIDAQSKKNRKSWGSINYQLQRLNRGRK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain