Glyma05g26403 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g26403): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g26403): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g26403

Feature Type:	gene_model
Chromosome:	Gm05
Start:	32382095
stop:	32382686
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g26403

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G48130	AT	Annotation by Michelle Graham. TAIR10: 1-cysteine peroxiredoxin 1 \| chr1:17780610-17781500 FORWARD LENGTH=216	SoyBase	E_val: 2.00E-56	ISS
GO:0009269	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to desiccation	SoyBase	N/A	ISS
GO:0010231	GO-bp	Annotation by Michelle Graham. GO Biological Process: maintenance of seed dormancy	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008379	GO-mf	Annotation by Michelle Graham. GO Molecular Function: thioredoxin peroxidase activity	SoyBase	N/A	ISS
GO:0016209	GO-mf	Annotation by Michelle Graham. GO Molecular Function: antioxidant activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0051920	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peroxiredoxin activity	SoyBase	N/A	ISS
PTHR10681	Panther	PEROXIREDOXIN	JGI		ISS
PTHR10681:SF17	Panther	PEROXIREDOXIN-6	JGI		ISS
PF00578	PFAM	AhpC/TSA family	JGI		ISS
UniRef100_Q6E2Z6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 1-Cys peroxiredoxin n=1 Tax=Medicago truncatula RepID=REHY_MEDTR	SoyBase	E_val: 5.00E-63	ISS
UniRef100_UPI000233A9DD	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A9DD related cluster n=1 Tax=unknown RepID=UPI000233A9DD	SoyBase	E_val: 5.00E-75	ISS

Expression Patterns of Glyma05g26403

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g26403 not represented in the dataset	Glyma05g26403 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g26403

Paralog	Evidence	Comments
Glyma08g09310	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g26403 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma05g26403

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g26403

Limit To All Plant Sequences

>Glyma05g26403.1   sequence type=CDS   gene model=Glyma05g26403   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGGCATTACCATTGGAGACACTATTCCTGACCTTCAAGTTGAAACTAACCAAGGAAAAATCAACCTTCATCAGTTCTGTGCTGATGGCTGGACCATCCTTTTCTCTCACCCAGGTGATTTCACCCCGGTTTGTACCACTGAGCTTGGCAAGATGGCTCAGTATGCTAAGGAGTTTTATCAACGAGGAGTGAAGTTATTGGGTTTATCTTGTGATGACGTACAATCCCACAATGAGTGGATCAAAGACATTGAAGCCTACACTCCAGGTGCGAAGGTGAACTATCCAATAATTGCTGATCCCAAGAGAGAAATCATCAAGTAA

Predicted protein sequences of Glyma05g26403

Limit To All Plant Sequences

>Glyma05g26403.1   sequence type=predicted peptide   gene model=Glyma05g26403   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPGITIGDTIPDLQVETNQGKINLHQFCADGWTILFSHPGDFTPVCTTELGKMAQYAKEFYQRGVKLLGLSCDDVQSHNEWIKDIEAYTPGAKVNYPIIADPKREIIK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain