SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma05g26381

Feature Type:gene_model
Chromosome:Gm05
Start:32365769
stop:32368865
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20030AT Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr4:10846362-10847246 FORWARD LENGTH=152 SoyBaseE_val: 8.00E-39ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
KOG0121 KOG Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) JGI ISS
PTHR24622Panther FAMILY NOT NAMED JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_G7JZL4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 3 subunit G n=1 Tax=Medicago truncatula RepID=G7JZL4_MEDTR SoyBaseE_val: 1.00E-55ISS
UniRef100_UPI000233A9DBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A9DB related cluster n=1 Tax=unknown RepID=UPI000233A9DB SoyBaseE_val: 7.00E-102ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g26381 not represented in the dataset

Glyma05g26381 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g09290 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g133300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g26381.1   sequence type=CDS   gene model=Glyma05g26381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGATGAATATGCTGGCTTCTTCGTTCACTGGTTATGCAAAACCCTTTGCAAGTGTAAACCCTTCTCTTCTTCCCTTCAGGGCTTCTTCTCTGCGCCATGACTACCCTCTTGCAAGCAAAATTGTTGTTAAAAATTTACCATATTCTACCGGTGAGACTACTTTGCAGAAGGAATTTTCAAATTTTGGCAAGATAGCTGAAGATATGAACACAAAAAGATCTAAGGGTATTGCTTTCATTCAATATACATGTCAAGATGATGCCATGCTTGCACTAGAAACCATGGATCAGAAGGATTTTTATGGTCGAACAATCGGCGTGGAAATTGCAAGACTGGGTTGGGATGATTTTGGTGCATCCCCAAGGGCCTCAGGACCCCCAAAGAAGTGGCATTTGCCTGAGCAAGGGGAAGTGGTAGATTGCTGGTACTGA

>Glyma05g26381.1   sequence type=predicted peptide   gene model=Glyma05g26381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEMNMLASSFTGYAKPFASVNPSLLPFRASSLRHDYPLASKIVVKNLPYSTGETTLQKEFSNFGKIAEDMNTKRSKGIAFIQYTCQDDAMLALETMDQKDFYGRTIGVEIARLGWDDFGASPRASGPPKKWHLPEQGEVVDCWY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo