SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G20030 | AT | Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr4:10846362-10847246 FORWARD LENGTH=152 | SoyBase | E_val: 8.00E-39 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| KOG0121 | KOG | Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) | JGI | ISS | |
| PTHR24622 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PF00076 | PFAM | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | JGI | ISS | |
| UniRef100_G7JZL4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 3 subunit G n=1 Tax=Medicago truncatula RepID=G7JZL4_MEDTR | SoyBase | E_val: 1.00E-55 | ISS |
| UniRef100_UPI000233A9DB | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A9DB related cluster n=1 Tax=unknown RepID=UPI000233A9DB | SoyBase | E_val: 7.00E-102 | ISS |
|
Glyma05g26381 not represented in the dataset |
Glyma05g26381 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma08g09290 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g133300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g26381.1 sequence type=CDS gene model=Glyma05g26381 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAGATGAATATGCTGGCTTCTTCGTTCACTGGTTATGCAAAACCCTTTGCAAGTGTAAACCCTTCTCTTCTTCCCTTCAGGGCTTCTTCTCTGCGCCATGACTACCCTCTTGCAAGCAAAATTGTTGTTAAAAATTTACCATATTCTACCGGTGAGACTACTTTGCAGAAGGAATTTTCAAATTTTGGCAAGATAGCTGAAGATATGAACACAAAAAGATCTAAGGGTATTGCTTTCATTCAATATACATGTCAAGATGATGCCATGCTTGCACTAGAAACCATGGATCAGAAGGATTTTTATGGTCGAACAATCGGCGTGGAAATTGCAAGACTGGGTTGGGATGATTTTGGTGCATCCCCAAGGGCCTCAGGACCCCCAAAGAAGTGGCATTTGCCTGAGCAAGGGGAAGTGGTAGATTGCTGGTACTGA
>Glyma05g26381.1 sequence type=predicted peptide gene model=Glyma05g26381 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEMNMLASSFTGYAKPFASVNPSLLPFRASSLRHDYPLASKIVVKNLPYSTGETTLQKEFSNFGKIAEDMNTKRSKGIAFIQYTCQDDAMLALETMDQKDFYGRTIGVEIARLGWDDFGASPRASGPPKKWHLPEQGEVVDCWY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
