Report for Sequence Feature Glyma05g26320
Feature Type: gene_model
Chromosome: Gm05
Start: 32299832
stop: 32301804
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g26320
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G15000 AT
Annotation by Michelle Graham. TAIR10: Ribosomal L27e protein family | chr4:8571896-8572303 FORWARD LENGTH=135
SoyBase E_val: 1.00E-79 ISS
GO:0001510 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA methylation
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0022625 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit
SoyBase N/A ISS
GO:0022626 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
KOG3418
KOG
60S ribosomal protein L27
JGI ISS
PTHR10497 Panther
60S RIBOSOMAL PROTEIN L27E
JGI ISS
PF00467 PFAM
KOW motif
JGI ISS
PF01777 PFAM
Ribosomal L27e protein family
JGI ISS
UniRef100_C6T3R4 UniRef
Annotation by Michelle Graham. Best UniRef hit: 60S ribosomal protein L27 n=1 Tax=Glycine max RepID=C6T3R4_SOYBN
SoyBase E_val: 3.00E-91 ISS
UniRef100_C6T3R4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L27 n=1 Tax=Glycine max RepID=C6T3R4_SOYBN
SoyBase E_val: 3.00E-91 ISS
Expression Patterns of Glyma05g26320
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma05g26320
Paralog Evidence Comments
Glyma08g09230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g26320 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.05g132800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma05g26320
Coding sequences of Glyma05g26320
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g26320.1 sequence type=CDS gene model=Glyma05g26320 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGAAGTTCCTGAAGCCTAACAAGGCAGTGATCGTCCTGCAGGGCCGCTACGCCGGGCGCAAGGCGGTGATCGTGAGGACCTTCGACGAGGGAACCAGGGAGCGCCCCTACGGCCACTGCCTCGTCGCCGGAATAAAGAAGTACCCAAGCAAGGTCATCAAGAAGGACTCCGCGAAGAAGACCGCGAAGAAATCTAGGGTTAAGGCCTTCGTGAAGCTCGTGAACTACCAGCACCTCATGCCCACGCGCTACACGCTCGACGTGGATCTAAAGGACGCTGTTACCCCCGATGTTCTAGCCACCAAGGACAAGAAGGTTACCGCTCTCAAGGAGACCAAGAAGCGCCTCGAGGAGAGGTTCAAGACCGGCAAGAATAGGTGGTTCTTCACCAAACTCAGATTCTGA
Predicted protein sequences of Glyma05g26320
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g26320.1 sequence type=predicted peptide gene model=Glyma05g26320 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVKFLKPNKAVIVLQGRYAGRKAVIVRTFDEGTRERPYGHCLVAGIKKYPSKVIKKDSAKKTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDAVTPDVLATKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
