SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g26290

Feature Type:gene_model
Chromosome:Gm05
Start:32286545
stop:32288806
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g26290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G07070AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L35Ae family protein | chr1:2168652-2169703 FORWARD LENGTH=112 SoyBaseE_val: 8.00E-73ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0887 KOG 60S ribosomal protein L35A/L37 JGI ISS
PTHR10902Panther 60S RIBOSOMAL PROTEIN L35A JGI ISS
PF01247PFAM Ribosomal protein L35Ae JGI ISS
UniRef100_C6TBI4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TBI4_SOYBN SoyBaseE_val: 3.00E-75ISS
UniRef100_I3NML8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L35aA n=1 Tax=Hevea brasiliensis RepID=I3NML8_HEVBR SoyBaseE_val: 3.00E-73ISS

Expression Patterns of Glyma05g26290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g26290
ParalogEvidenceComments
Glyma08g09200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g26290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g132500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g26290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g26290
>Glyma05g26290.1   sequence type=CDS   gene model=Glyma05g26290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAGGGACGCCAAGGAGAACGTGTCAGACTCTACGTGAGGGGTACAATCCTTGGATACAAAAGGTCCAAGTCAAACCAGTATCCAAATACATCCCTGATCCAAATTGAGGGTGTGAATGCCAAAGAAGAAGTAGCATGGTATGCTGGCAAGAAAATGGCCTATATCTACAAGGCTAAGGTGAAGAAGAATGGAAGCCATTACCGCTGCATATGGGGCAAGGTTACAAGGCCTCATGGTAACAGTGGTATTGTCCGTGCAAAATTCAAGTCGAACCTTCCACCCAAATCAATGGGAGCCCGAGTAAGAGTATTCATGTATCCAAGCAACATATGA
Predicted protein sequences of Glyma05g26290
>Glyma05g26290.1   sequence type=predicted peptide   gene model=Glyma05g26290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNAKEEVAWYAGKKMAYIYKAKVKKNGSHYRCIWGKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMYPSNI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo