SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g25810

Feature Type:gene_model
Chromosome:Gm05
Start:31881852
stop:31883064
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g25810
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29930AT Annotation by Michelle Graham. TAIR10: chlorophyll A/B binding protein 1 | chr1:10478071-10478874 FORWARD LENGTH=267 SoyBaseE_val: 6.00E-170ISS
GO:0009765GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030076GO-cc Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex SoyBaseN/AISS
GO:0016168GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding SoyBaseN/AISS
PTHR21649Panther CHLOROPHYLL A/B BINDING PROTEIN JGI ISS
PF00504PFAM Chlorophyll A-B binding protein JGI ISS
UniRef100_C6TLM4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TLM4_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q39831UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyll a/b-binding protein n=1 Tax=Glycine max RepID=Q39831_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma05g25810
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g25810
ParalogEvidenceComments
Glyma08g08770 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g25810 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g128000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g25810
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g25810
>Glyma05g25810.1   sequence type=CDS   gene model=Glyma05g25810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCAGCCTCCTCCATGGCTCTCTCTTCCCCATCCTTGGCTGGCAAGGCCGTGAAGCTGGGCCCATCAGCCCCCGAAGTCGGGAGGGTCAGCATGAGGAAGACCGTCACCAAGCAGGCCTCCTCCGGAAGCCCATGGTACGGCCCAGACCGCGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCGTCCTACCTCACTGGCGAGTTCCCAGGTGACTACGGCTGGGACACTGCTGGGCTTTCGGCCGACCCAGAAACCTTCGCCAGAAACCGTGAGCTCGAAGTGATCCACTCCAGGTGGGCCATGCTCGGGGCCTTGGGCTGCGTCTTCCCCGAACTATTGTCCCGCAACGGGGTCAAGTTTGGAGAAGCTGTGTGGTTCAAGGCCGGGTCCCAGATCTTCAGCGAGGGTGGGCTGGACTACTTGGGCAACCCAAGCCTTGTCCACGCCCAGAGCATCCTCGCCATCTGGGCCACCCAAGTTATCCTAATGGGTGCTGTTGAGGGTTATCGTATTGCTGGTGGGCCCCTCGGTGAGGTCACTGACCCAATCTACCCTGGTGGCAGCTTTGACCCATTGGGCCTTGCTGATGACCCAGAGGCTTTTGCTGAGCTTAAGGTGAAGGAACTCAAGAACGGGAGATTGGCCATGTTCTCTATGTTTGGGTTCTTTGTTCAGGCCATTGTCACCGGTAAGGGTCCATTGGAGAACCTTGCTGATCACCTTGCGGACCCAGTCAACAACAATGCCTGGGCCTACGCCACCAACTTCGTCCCCGGCAAGTGA
Predicted protein sequences of Glyma05g25810
>Glyma05g25810.1   sequence type=predicted peptide   gene model=Glyma05g25810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAASSMALSSPSLAGKAVKLGPSAPEVGRVSMRKTVTKQASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo