|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G61820 | AT | Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: vacuole; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Stress up-regulated Nod 19 (InterPro:IPR011692); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:24834505-24836223 REVERSE LENGTH=475 | SoyBase | E_val: 9.00E-14 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009610 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to symbiotic fungus | SoyBase | N/A | ISS |
| GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0046482 | GO-bp | Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process | SoyBase | N/A | ISS |
| GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF07712 | PFAM | Stress up-regulated Nod 19 | JGI | ISS | |
| UniRef100_I1K2Z5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1K2Z5_SOYBN | SoyBase | E_val: 7.00E-33 | ISS |
| UniRef100_Q64EX4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: MtN19-like protein n=1 Tax=Pisum sativum RepID=Q64EX4_PEA | SoyBase | E_val: 6.00E-27 | ISS |
|
Glyma05g25711 not represented in the dataset |
Glyma05g25711 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g127100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g25711.1 sequence type=CDS gene model=Glyma05g25711 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTCTTCAATAGATGTTATCCTCAACCAGGTTCTGTAAAGATAATTGATGGTGAAACTTTAACTCTAGAGTCTAACTACAGCAGCAGCCGTGAACACACTGGAGTGATGGGACTTTTCTATCTATTGGTGGCAGAACAGCTTCCACACCAACACTTCAGACATACCCCTCGTTCTTCATTCTCTATGGATATAAATAGTATATTTCATTGA
>Glyma05g25711.1 sequence type=predicted peptide gene model=Glyma05g25711 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFFNRCYPQPGSVKIIDGETLTLESNYSSSREHTGVMGLFYLLVAEQLPHQHFRHTPRSSFSMDINSIFH*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||