SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma05g25340

Feature Type:gene_model
Chromosome:Gm05
Start:31481126
stop:31482429
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06860AT Annotation by Michelle Graham. TAIR10: polygalacturonase inhibiting protein 1 | chr5:2132373-2133434 FORWARD LENGTH=330 SoyBaseE_val: 4.00E-94ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0090353GO-mf Annotation by Michelle Graham. GO Molecular Function: polygalacturonase inhibitor activity SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PF00560PFAM Leucine Rich Repeat JGI ISS
PF08263PFAM Leucine rich repeat N-terminal domain JGI ISS
UniRef100_I1K2V9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2V9_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q0WX04UniRef Annotation by Michelle Graham. Most informative UniRef hit: Polygalacturonase inhibiting protein n=1 Tax=Glycine max RepID=Q0WX04_SOYBN SoyBaseE_val: 4.00E-172ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g08360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g123700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g25340.1   sequence type=CDS   gene model=Glyma05g25340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACGCTTAAGCATTCTGATTCTCCTACTCATAGTCCTATCCTTCAGTTCCGCACTTTCAGAACTATGCAACCCACGAGACAAACAAGTCCTTCTTAAAATCAAGAAAGAGCTTGGCAACCCAACCACTCTTTCTTCATGGCTCCCAACCACTGACTGTTGCAACAATTGGGTAGGTGTCTCATGTGACACCGTCACCCAAACATACCGCGTCCACAACCTCGACCTCTCCGACCTTAACCTCCCCAAACCCTACTCTATTCCTTTCTCCATAGGTAACATTCCCTACCTGGAGTTTCTTTCCATCACCGGAACCCCCAACATCATTGGCACAATACCCCCGACAATCACCAAACTCACCAAGCTTCGTAATCTCTATATCAAATACACCAATGTCTCTGGCCAGATACCTCGTTTCTTGTCCCAAATCAAAACCCTAGAATTCCTCGACCTCTCCTACAACAAACTCTCTGGCAACCTCCCTGCCTGGCTCCCTTCTCTCCCCAACCTCGTAGGAATCTCCTTCGACGGCAACCGCATCTCCGGCGCCATACCGGACTCCTTCGGCTACTTCCCGAAGTCGTTCGTGATGTTGTCGCTCTCCCGCAACCGCCTCACCGGGAAGATTCCGGCGACGTTGGCGAAGCTGGACGTGAAGTTTGTGTACTTGTCTAAGAACATGCTGGAGGGTGACGCGTCATTGTTGTTCGGGTCGGAGAAACACACGCGGCACATGTATCTGGGAAACAATTCGTTTGCTTTTGATTTGGGAAAACTAGGGTTGTCGAAGACCTTGGAGGGCTTGGATCTTAGCCATAATCGTTTATATGGGACGCTACCTAAGGGACTTACGTCGCTTAAGGATCTGTATTATTTGGATGTGAGCTACAATAATCTATGTGGAAAGATTCCACGGGGTGGTAAATTGCAAGAATTTGATGCATCTACCTATGCTCATAACAAGTGCTTGTGTGGCTCTCCTCTTCCAAGCTGCAAACGGTTCTAG

>Glyma05g25340.1   sequence type=predicted peptide   gene model=Glyma05g25340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRLSILILLLIVLSFSSALSELCNPRDKQVLLKIKKELGNPTTLSSWLPTTDCCNNWVGVSCDTVTQTYRVHNLDLSDLNLPKPYSIPFSIGNIPYLEFLSITGTPNIIGTIPPTITKLTKLRNLYIKYTNVSGQIPRFLSQIKTLEFLDLSYNKLSGNLPAWLPSLPNLVGISFDGNRISGAIPDSFGYFPKSFVMLSLSRNRLTGKIPATLAKLDVKFVYLSKNMLEGDASLLFGSEKHTRHMYLGNNSFAFDLGKLGLSKTLEGLDLSHNRLYGTLPKGLTSLKDLYYLDVSYNNLCGKIPRGGKLQEFDASTYAHNKCLCGSPLPSCKRF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo