SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g25214): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g25214): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g25214

Feature Type:gene_model
Chromosome:Gm05
Start:31353041
stop:31353373
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g25214
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15570AT Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr4:8893043-8898858 FORWARD LENGTH=818 SoyBaseE_val: 2.00E-13ISS
GO:0009553GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac development SoyBaseN/AISS
GO:0009875GO-bp Annotation by Michelle Graham. GO Biological Process: pollen-pistil interaction SoyBaseN/AISS
GO:0010183GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube guidance SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7JY95UniRef Annotation by Michelle Graham. Most informative UniRef hit: Helicase sen1 n=1 Tax=Medicago truncatula RepID=G7JY95_MEDTR SoyBaseE_val: 2.00E-17ISS
UniRef100_I1KR82UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KR82_SOYBN SoyBaseE_val: 3.00E-31ISS

Expression Patterns of Glyma05g25214
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g25214 not represented in the dataset
Glyma05g25214 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g25214 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma05g25214
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g25214
>Glyma05g25214.1   sequence type=CDS   gene model=Glyma05g25214   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGTGGTGGGGAAGGAAAAGCTTCAGGAAGAATCTGTAATCCGCCGCTTCTACCAGATTATTCTTAGTTGGGACTACTTTGCTCTCCTCAAGAAATCCAAGAAGCAGAAAAACAACGAGAAGAAAGGGACTGTGGTGCCGACACTCGTGAAGGTGAAGCAACGCTACAAAGATGTTGATGATTACATTGCCACATACGAGTCCCTCGTCTTTGAAGAAGCCAAATCCCAGATCATTTAG
Predicted protein sequences of Glyma05g25214
>Glyma05g25214.1   sequence type=predicted peptide   gene model=Glyma05g25214   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVVGKEKLQEESVIRRFYQIILSWDYFALLKKSKKQKNNEKKGTVVPTLVKVKQRYKDVDDYIATYESLVFEEAKSQII*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo