|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G16280 | AT | Annotation by Michelle Graham. TAIR10: RNA binding;abscisic acid binding | chr4:9208564-9214412 REVERSE LENGTH=533 | SoyBase | E_val: 2.00E-47 | ISS |
| GO:0007062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion | SoyBase | N/A | ISS |
| GO:0009553 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo sac development | SoyBase | N/A | ISS |
| GO:0009790 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0031048 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA | SoyBase | N/A | ISS |
| GO:0040029 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of gene expression, epigenetic | SoyBase | N/A | ISS |
| GO:0045132 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation | SoyBase | N/A | ISS |
| GO:0048316 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed development | SoyBase | N/A | ISS |
| GO:0000785 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chromatin | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| PTHR24011 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24011:SF260 | Panther | JGI | ISS | ||
| PF00076 | PFAM | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | JGI | ISS | |
| UniRef100_I1KMP5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KMP5_SOYBN | SoyBase | E_val: 3.00E-55 | ISS |
| UniRef100_Q531A8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: FCA gamma n=1 Tax=Pisum sativum RepID=Q531A8_PEA | SoyBase | E_val: 1.00E-53 | ISS |
|
Glyma05g25030 not represented in the dataset |
Glyma05g25030 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g25030.1 sequence type=CDS gene model=Glyma05g25030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GTTCCTTTCTTCAATAGCCTTGTATCAAGTGGAGTTCTAAATCTGGCCATGGTTGAGTGTGTGGACAATCAGAAGTCTCTTGTCTTCTCCCAAATAGTTGCTACAAAATACACCAGAAGAATCAATGTCATTTGTTTGATGAGTTGTTGTTTCATAAAATATGCTACCTCCGAAGAAGCTGATCAGGCAATTAGAGCATTGCATAATCAACATACTCTTCCTGGAGGTGTTGGTCCAATCCAAGTGCGATATGCTGATGGTGAACGGGAACGCCTTGGTGTTGTTGAGTACAAATTATTTGTGGGCTCTTTGAACAAACAGGCTACCGTAAAGGAAGTTGAGGAAATTTTCTCAAAATATGGCCGGGTTGAAGATGTTTATCTTATGCGCGATGAGAAGAAACAAAGTCGTGGTATGTTTCCTACCTATATGGGATATTAG
>Glyma05g25030.1 sequence type=predicted peptide gene model=Glyma05g25030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high VPFFNSLVSSGVLNLAMVECVDNQKSLVFSQIVATKYTRRINVICLMSCCFIKYATSEEADQAIRALHNQHTLPGGVGPIQVRYADGERERLGVVEYKLFVGSLNKQATVKEVEEIFSKYGRVEDVYLMRDEKKQSRGMFPTYMGY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||