SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g24930

Feature Type:gene_model
Chromosome:Gm05
Start:31103480
stop:31105750
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g24930
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14320AT Annotation by Michelle Graham. TAIR10: Zinc-binding ribosomal protein family protein | chr4:8242684-8243805 REVERSE LENGTH=105 SoyBaseE_val: 6.00E-65ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3464 KOG 60S ribosomal protein L44 JGI ISS
PTHR10369Panther 60S RIBOSOMAL PROTEIN L44 JGI ISS
PF00935PFAM Ribosomal protein L44 JGI ISS
UniRef100_G7L0P4UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L44 n=2 Tax=Papilionoideae RepID=G7L0P4_MEDTR SoyBaseE_val: 3.00E-67ISS
UniRef100_I1K2S3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2S3_SOYBN SoyBaseE_val: 8.00E-68ISS

Expression Patterns of Glyma05g24930
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g24930 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g120700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g24930
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g24930
>Glyma05g24930.1   sequence type=CDS   gene model=Glyma05g24930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAACGTTCCGAAGACAAAGAAGACCTACTGCAAGAGCAAGGAGTGCAGGAAGCACACGCTCCACAAGGTCACCCAATACAAGAAGGGCAAGGACAGCATCGCCGCTCAGGGAAAACGCCGTTATGACCGCAAACAGTCCGGTTACGGTGGCCAGACCAAGCCCGTTTTCCACAAAAAGGCGAAAACCACCAAGAAAATTGTGTTGAGGCTCCAGTGCCAAGGATGCAAGCATGTCTCGCAGCACGCTATCAAGAGGTGCAAGCACTTTGAGATCGGTGGTGACAAGAAGGGAAAAGGAACATCTCTCTTCTAG
Predicted protein sequences of Glyma05g24930
>Glyma05g24930.1   sequence type=predicted peptide   gene model=Glyma05g24930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVNVPKTKKTYCKSKECRKHTLHKVTQYKKGKDSIAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHAIKRCKHFEIGGDKKGKGTSLF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo