Glyma05g24570 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g24570

Feature Type:	gene_model
Chromosome:	Gm05
Start:	30731063
stop:	30733455
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g24570

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G26740	AT	Annotation by Michelle Graham. TAIR10: Ribosomal L32p protein family \| chr1:9245280-9246555 REVERSE LENGTH=134	SoyBase	E_val: 3.00E-33	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0015934	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PF01783	PFAM	Ribosomal L32p protein family	JGI		ISS
UniRef100_B6EV28	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L32 n=1 Tax=Populus alba RepID=B6EV28_POPAL	SoyBase	E_val: 5.00E-37	ISS
UniRef100_I1K2P4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2P4_SOYBN	SoyBase	E_val: 7.00E-86	ISS

Expression Patterns of Glyma05g24570

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g24570

Paralog	Evidence	Comments
Glyma08g07760	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g24570 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g118100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g24570

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g24570

Limit To All Plant Sequences

>Glyma05g24570.1   sequence type=CDS   gene model=Glyma05g24570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCGAGGCTCGCAATTGTGAGGAGCACCAGATGGAGATTGAGCAGCGTTTTAGGGTTCAATAGGTTTATTCATTCGGTGCCCCAATCTCCTCCTTTAGCTGGAAGCATTGATCTTGGGGTTCGGTCGCCGCAATCCGTTTTGCCCGAGTTTTGTTCCCCAAGTTTCTCTTATGGGGGCTCCATGGAGCTCATGGCTGTCCCAAAACGCAAGGTTTCTCCCCATAAAAGAGGAATAAGGAATGGACCAAAAGCTCTGAAACCTATTCCTGTGATTGTCCTATGCAAGAGTTGTGGTCGTGCTAGGCTTCCACACTTCTTTTGTTGTGGTGGGAAACCAAATCAGGGTAATACTGGTGAACATAAAGGTAGTACAAGCTAA

Predicted protein sequences of Glyma05g24570

Limit To All Plant Sequences

>Glyma05g24570.1   sequence type=predicted peptide   gene model=Glyma05g24570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAARLAIVRSTRWRLSSVLGFNRFIHSVPQSPPLAGSIDLGVRSPQSVLPEFCSPSFSYGGSMELMAVPKRKVSPHKRGIRNGPKALKPIPVIVLCKSCGRARLPHFFCCGGKPNQGNTGEHKGSTS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain