SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g24470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g24470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g24470

Feature Type:gene_model
Chromosome:Gm05
Start:30650608
stop:30653049
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G33520AT Annotation by Michelle Graham. TAIR10: P-type ATP-ase 1 | chr4:16118993-16120542 FORWARD LENGTH=237 SoyBaseE_val: 2.00E-39ISS
GO:0006754GO-bp Annotation by Michelle Graham. GO Biological Process: ATP biosynthetic process SoyBaseN/AISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009767GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain SoyBaseN/AISS
GO:0030001GO-bp Annotation by Michelle Graham. GO Biological Process: metal ion transport SoyBaseN/AISS
GO:0035434GO-bp Annotation by Michelle Graham. GO Biological Process: copper ion transmembrane transport SoyBaseN/AISS
GO:0046034GO-bp Annotation by Michelle Graham. GO Biological Process: ATP metabolic process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005375GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion transmembrane transporter activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0015662GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism SoyBaseN/AISS
GO:0043682GO-mf Annotation by Michelle Graham. GO Molecular Function: copper-transporting ATPase activity SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR24093Panther FAMILY NOT NAMED JGI ISS
PTHR24093:SF26Panther SUBFAMILY NOT NAMED JGI ISS
PF00403PFAM Heavy-metal-associated domain JGI ISS
UniRef100_B9GF99UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heavy metal ATPase (Fragment) n=1 Tax=Populus trichocarpa RepID=B9GF99_POPTR SoyBaseE_val: 3.00E-39ISS
UniRef100_I1K2N6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2N6_SOYBN SoyBaseE_val: 8.00E-147ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g24470 not represented in the dataset

Glyma05g24470 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g117300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g24470.1   sequence type=CDS   gene model=Glyma05g24470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCTGCGTTCTCCATCACCACCAAGGCGCACGTGGCGCTTTTCAGAGTGCTCCACCGTCATTTCCACGGAGCTCCTAAACGCGTCTTGCTTCGCTGCAACCTCAAACGCCTTATTGCTTCCTACAGTAGCAGCAACTGCTGCCGCATTCCGTGTTCTTTCGCCTCCGCACCGTCGCCTTCCTCGCTCGGATCCTTCCGCGGACTACTCCCGCGAACGCCGCCGTGCAGTCCGCGCTGCATTTCCTTTGCTTCTCCTGCCGGCGGTGGAAATGGCGGCGCTGGAACCGGAGACGGTGGTGGAGGTGGCGGTTCTGGCGGGGAGTCCGGAGATGTTAATCTCAAACTGGTTGGAGACGCGTCTCAGGAGCTTTCGGCACTTTCACCCGATGTTATCATTCTCGATGTTTCGGGAATGGTATGCGGGGGATGTGCGGCTACTGTGAAAAGGATACTGGAAAGTCAACCTCAAGTGTCATCTGCTAGTGTAAATTTAACAACAGAGACAGCAATAGTCTGGCCTGTATCTGAAGCAAAAAATGCACCAAATTGGCAAAAGCAATTAGGGGAGGCACTTGCAGAGCATTTAACTAGTTGTGGCTATAATTCTAGCCTTCGAGGTGAAGAAGCTAGCTACTGA

>Glyma05g24470.1   sequence type=predicted peptide   gene model=Glyma05g24470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSAFSITTKAHVALFRVLHRHFHGAPKRVLLRCNLKRLIASYSSSNCCRIPCSFASAPSPSSLGSFRGLLPRTPPCSPRCISFASPAGGGNGGAGTGDGGGGGGSGGESGDVNLKLVGDASQELSALSPDVIILDVSGMVCGGCAATVKRILESQPQVSSASVNLTTETAIVWPVSEAKNAPNWQKQLGEALAEHLTSCGYNSSLRGEEASY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo