Report for Sequence Feature Glyma05g24090
Feature Type: gene_model
Chromosome: Gm05
Start: 30088661
stop: 30089679
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g24090
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
PF08213 PFAM
Mitochondrial domain of unknown function (DUF1713)
JGI ISS
UniRef100_I1K2L7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2L7_SOYBN
SoyBase E_val: 1.00E-83 ISS
Expression Patterns of Glyma05g24090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma05g24090
Paralog Evidence Comments
Glyma19g07320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g24090 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.05g114700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma05g24090
Coding sequences of Glyma05g24090
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g24090.1 sequence type=CDS gene model=Glyma05g24090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTTCAACACTTCAGAAACTGCTTCGAAAACCATCACCTCTACCACCCTTCAGATTCATCACTGCCCTCAACCCACCGCAACCCCAAAACCAAAACCAAAACCCCATCCTCACTCTCACTCGCGACCCTCCCCAACAATGTAACGCTCAACCCTTCGATGATGCCCCCACCGTGATCTTTCCCAGTTTCCCCTTTGGCTTCTTCCCAAGACCCGTTTCTGAAAGCGGGTTTCGTGGCGGCGATGATGCCGGGGTGGAAGAAGAAGACTCTGGAACCCTCTGGGCGGACAGCGTGAAGAAGAAGCGGAAGAAGAAGATGAACAAGCACAAGTACCAGAAGCTCAGGAAGCGCATGAGGAGACAGACGTAG
Predicted protein sequences of Glyma05g24090
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g24090.1 sequence type=predicted peptide gene model=Glyma05g24090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASTLQKLLRKPSPLPPFRFITALNPPQPQNQNQNPILTLTRDPPQQCNAQPFDDAPTVIFPSFPFGFFPRPVSESGFRGGDDAGVEEEDSGTLWADSVKKKRKKKMNKHKYQKLRKRMRRQT*