SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g24018): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g24018): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g24018

Feature Type:gene_model
Chromosome:Gm05
Start:29902003
stop:29904447
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g24018
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G46240AT Annotation by Michelle Graham. TAIR10: potassium channel in Arabidopsis thaliana 1 | chr5:18743652-18746561 REVERSE LENGTH=677 SoyBaseE_val: 1.00E-46ISS
GO:0006811GO-bp Annotation by Michelle Graham. GO Biological Process: ion transport SoyBaseN/AISS
GO:0006813GO-bp Annotation by Michelle Graham. GO Biological Process: potassium ion transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005216GO-mf Annotation by Michelle Graham. GO Molecular Function: ion channel activity SoyBaseN/AISS
GO:0005242GO-mf Annotation by Michelle Graham. GO Molecular Function: inward rectifier potassium channel activity SoyBaseN/AISS
GO:0005249GO-mf Annotation by Michelle Graham. GO Molecular Function: voltage-gated potassium channel activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0030551GO-mf Annotation by Michelle Graham. GO Molecular Function: cyclic nucleotide binding SoyBaseN/AISS
PTHR10217Panther VOLTAGE AND LIGAND GATED POTASSIUM CHANNEL JGI ISS
PTHR10217:SF6Panther EAG-RELATED VOLTAGE-GATED POTASSIUM CHANNEL JGI ISS
PF00520PFAM Ion transport protein JGI ISS
UniRef100_G7IPW9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Potassium channel n=1 Tax=Medicago truncatula RepID=G7IPW9_MEDTR SoyBaseE_val: 6.00E-47ISS
UniRef100_UPI000233C604UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C604 related cluster n=1 Tax=unknown RepID=UPI000233C604 SoyBaseE_val: 9.00E-50ISS

Expression Patterns of Glyma05g24018
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g24018 not represented in the dataset
Glyma05g24018 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g24018 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma05g24018
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g24018
>Glyma05g24018.1   sequence type=CDS   gene model=Glyma05g24018   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAATGCTGATGATAAGCAGGTAGTGGTAGAAAGTTTTTTGGCAAGAAACCAGCATGAGCAGAAGTCAAGAAAACAAAAACATGAGGTTATATCAAGTTCTCTGTTTGCAAGACTTGAAAAGGTCATTCACTTCAATTATTTTTGGACTAGGTGCACAAAGCTCATTATTGTGAACTTGTTTTCGGTGCATTGTGTGGGATGCTTTAACTATCTCATTGCTGATAGGTATCTAGATTCCAAAAGAACATGGATTGGTGCAGTGTACCCAAATTTCAAAGAAGAAAGTCTTTGGGACAAATATGTCACTGCAATATATTGGTCCATTGTCACTGTTACTACCACTGGCTATGGGGATTTACACAAGAGAGATGTTGTTTAA
Predicted protein sequences of Glyma05g24018
>Glyma05g24018.1   sequence type=predicted peptide   gene model=Glyma05g24018   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDNADDKQVVVESFLARNQHEQKSRKQKHEVISSSLFARLEKVIHFNYFWTRCTKLIIVNLFSVHCVGCFNYLIADRYLDSKRTWIGAVYPNFKEESLWDKYVTAIYWSIVTVTTTGYGDLHKRDVV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo