|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G09440 | AT | Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr1:3045513-3047393 REVERSE LENGTH=466 | SoyBase | E_val: 1.00E-26 | ISS |
| GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
| GO:0009832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis | SoyBase | N/A | ISS |
| GO:0010413 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process | SoyBase | N/A | ISS |
| GO:0045492 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
| GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
| GO:0004713 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
| GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
| PTHR24420 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PF00069 | PFAM | Protein kinase domain | JGI | ISS | |
| UniRef100_F4I0Z0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase family protein n=1 Tax=Arabidopsis thaliana RepID=F4I0Z0_ARATH | SoyBase | E_val: 5.00E-24 | ISS |
| UniRef100_I1KMK8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KMK8_SOYBN | SoyBase | E_val: 7.00E-26 | ISS |
|
Glyma05g23986 not represented in the dataset |
Glyma05g23986 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g114100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g23986.1 sequence type=CDS gene model=Glyma05g23986 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAATTTGAGAAGCCTAGTGTTTGCAGAGTCTGAAAAGCTGAGATTGGATCACATATATTATCTGATTCTAGGGTTAAATTTTAATTCACTCTACTGTCTGACTCTCTCGCTCACGCCTAGCACGTTTTTTTTTTCTCTTGCTCACTCTACTCCGTTCCTTTCCCAATCGCCACTCAACCATCACCATTGCGACTCACGAGGAGACTCAGCCTCCACGACCGACGTTCCCTCGACATCCTTCAACAAAGTTTTCGGCATTTGTTTGAGGCTAACTTACTTGCACGAGGAAATTAAGCCAAAAGTTGTACATCGAGATATTAAATCAAGCAATATTCTAATTGATGATGACTTCAATGCCAAAATATTTGACTTTGGGCTGGCAAAGTTATTGGGTGTTGGAAAAAGTCATATCACAACTCGAGTAATGGGTACTCTTGGGTAA
>Glyma05g23986.1 sequence type=predicted peptide gene model=Glyma05g23986 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MNLRSLVFAESEKLRLDHIYYLILGLNFNSLYCLTLSLTPSTFFFSLAHSTPFLSQSPLNHHHCDSRGDSASTTDVPSTSFNKVFGICLRLTYLHEEIKPKVVHRDIKSSNILIDDDFNAKIFDFGLAKLLGVGKSHITTRVMGTLG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||