SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g23986

Feature Type:gene_model
Chromosome:Gm05
Start:29861875
stop:29864968
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g23986
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09440AT Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr1:3045513-3047393 REVERSE LENGTH=466 SoyBaseE_val: 1.00E-26ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_F4I0Z0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase family protein n=1 Tax=Arabidopsis thaliana RepID=F4I0Z0_ARATH SoyBaseE_val: 5.00E-24ISS
UniRef100_I1KMK8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KMK8_SOYBN SoyBaseE_val: 7.00E-26ISS

Expression Patterns of Glyma05g23986
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g23986 not represented in the dataset
Glyma05g23986 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g23986 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g114100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g23986
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g23986
>Glyma05g23986.1   sequence type=CDS   gene model=Glyma05g23986   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATTTGAGAAGCCTAGTGTTTGCAGAGTCTGAAAAGCTGAGATTGGATCACATATATTATCTGATTCTAGGGTTAAATTTTAATTCACTCTACTGTCTGACTCTCTCGCTCACGCCTAGCACGTTTTTTTTTTCTCTTGCTCACTCTACTCCGTTCCTTTCCCAATCGCCACTCAACCATCACCATTGCGACTCACGAGGAGACTCAGCCTCCACGACCGACGTTCCCTCGACATCCTTCAACAAAGTTTTCGGCATTTGTTTGAGGCTAACTTACTTGCACGAGGAAATTAAGCCAAAAGTTGTACATCGAGATATTAAATCAAGCAATATTCTAATTGATGATGACTTCAATGCCAAAATATTTGACTTTGGGCTGGCAAAGTTATTGGGTGTTGGAAAAAGTCATATCACAACTCGAGTAATGGGTACTCTTGGGTAA
Predicted protein sequences of Glyma05g23986
>Glyma05g23986.1   sequence type=predicted peptide   gene model=Glyma05g23986   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNLRSLVFAESEKLRLDHIYYLILGLNFNSLYCLTLSLTPSTFFFSLAHSTPFLSQSPLNHHHCDSRGDSASTTDVPSTSFNKVFGICLRLTYLHEEIKPKVVHRDIKSSNILIDDDFNAKIFDFGLAKLLGVGKSHITTRVMGTLG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo