SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g23931

Feature Type:gene_model
Chromosome:Gm05
Start:29796548
stop:29796917
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g23931
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34640AT Annotation by Michelle Graham. TAIR10: squalene synthase 1 | chr4:16538489-16541655 FORWARD LENGTH=410 SoyBaseE_val: 2.00E-25ISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006598GO-bp Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process SoyBaseN/AISS
GO:0008610GO-bp Annotation by Michelle Graham. GO Biological Process: lipid biosynthetic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009698GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0042398GO-bp Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005789GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0004310GO-mf Annotation by Michelle Graham. GO Molecular Function: farnesyl-diphosphate farnesyltransferase activity SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0016765GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups SoyBaseN/AISS
PTHR11626Panther FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE JGI ISS
UniRef100_C6TGQ1UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TGQ1_SOYBN SoyBaseE_val: 6.00E-26ISS
UniRef100_O22107UniRef Annotation by Michelle Graham. Most informative UniRef hit: Squalene synthase n=1 Tax=Glycine max RepID=O22107_SOYBN SoyBaseE_val: 1.00E-24ISS

Expression Patterns of Glyma05g23931
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g23931 not represented in the dataset
Glyma05g23931 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g23931 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g113900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g23931
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g23931
>Glyma05g23931.1   sequence type=CDS   gene model=Glyma05g23931   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCCACAAGGTTTCTCGAAGTTTCACCCTCGTCATTCACCAACTCGGCACCGAGCTTCGTAACGCCGCTAGTACCTCGCATTTCTCGTTCTACCTACACCGTTCTGCTGAGGATGATACTAGCATAGAAACAGATGTCAAGGTGCCAATACTGATAGCCTTTCACTGTCATATTTATGATCGTGATTGGCACTTTTCATGTGAGTGTGTCATTCTTTTTTGCTTTTCTTTTTTTAAATAA
Predicted protein sequences of Glyma05g23931
>Glyma05g23931.1   sequence type=predicted peptide   gene model=Glyma05g23931   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLHKVSRSFTLVIHQLGTELRNAASTSHFSFYLHRSAEDDTSIETDVKVPILIAFHCHIYDRDWHFSCECVILFCFSFFK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo