SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g23620

Feature Type:gene_model
Chromosome:Gm05
Start:29277243
stop:29277917
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g23620
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G17810AT Annotation by Michelle Graham. TAIR10: C2H2 and C2HC zinc fingers superfamily protein | chr4:9906918-9907532 FORWARD LENGTH=204 SoyBaseE_val: 8.00E-30ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006417GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of translation SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
UniRef100_D7R6G3UniRef Annotation by Michelle Graham. Most informative UniRef hit: PALMATE-LIKE PENTAFOLIATA1 n=1 Tax=Medicago truncatula RepID=D7R6G3_MEDTR SoyBaseE_val: 1.00E-61ISS
UniRef100_I1K2J0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2J0_SOYBN SoyBaseE_val: 6.00E-143ISS

Expression Patterns of Glyma05g23620
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g23620
ParalogEvidenceComments
Glyma17g16690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g23620 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g111400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g23620
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g23620
>Glyma05g23620.1   sequence type=CDS   gene model=Glyma05g23620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGAATCCTAGGGACCAATATCATCATCAGGACCAAGATCAAGATGAGTCGTGGGAAGTCAGAGCCTTCGCAGAAGACACCAGTAACATCATGGGCACCACCTGGCCTCCTAGGTCCTACTCCTGCACCTTCTGTAGAAAGGAGTTCCGTTCAGCACAAGCCCTCGGCGGCCACATGAACGTTCACCGCCGCGACCGCGCCCGCCTCCACCAAGCCTCAGTACCCCACAACAACCCCTCTTTTTCTCCCACACCCTCTTTTCTTAACATCTCTCATCAGGAGCCTTTTGTTGCAAATGGGGGTTTGTGCCTCTTGTACCCCTTTCCAAGCCCTAATAACAATGCTCCATTTTCCTCTCTAGGCCACAACAATAATGCATGTGGTGACTCACCTTCCACTGCTTTTTCAGTTTCTTCTTCTCATTCCCTTCAGTACCCTCCAATGAGGGTGCCTAGTTGCTCAGCTTCTACTTCCTTTGATTTCTCTGTGGCTCAGCCTGCTCCTCCTGCTGTAGGGAGGAATAATAATGGTTTCTCTTCTTCTTATTCTGGGAAAGTGGAACAAGAACCACCCACAAACGACTCTTCAACCCATCATGGTCATGGCCGCCACCACCATGATGAGGAGCTTGATCTAGAGCTCCGCTTGGGAAATAAATCAACATCAACGTGA
Predicted protein sequences of Glyma05g23620
>Glyma05g23620.1   sequence type=predicted peptide   gene model=Glyma05g23620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWNPRDQYHHQDQDQDESWEVRAFAEDTSNIMGTTWPPRSYSCTFCRKEFRSAQALGGHMNVHRRDRARLHQASVPHNNPSFSPTPSFLNISHQEPFVANGGLCLLYPFPSPNNNAPFSSLGHNNNACGDSPSTAFSVSSSHSLQYPPMRVPSCSASTSFDFSVAQPAPPAVGRNNNGFSSSYSGKVEQEPPTNDSSTHHGHGRHHHDEELDLELRLGNKSTST*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo