SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g23300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g23300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g23300

Feature Type:gene_model
Chromosome:Gm05
Start:28968142
stop:28970456
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G47010AT Annotation by Michelle Graham. TAIR10: RNA helicase, putative | chr5:19072009-19078856 FORWARD LENGTH=1254 SoyBaseE_val: 3.00E-36ISS
GO:0000184GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process, nonsense-mediated decay SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009755GO-bp Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0016246GO-bp Annotation by Michelle Graham. GO Biological Process: RNA interference SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0000932GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasmic mRNA processing body SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003724GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA helicase activity SoyBaseN/AISS
GO:0004386GO-mf Annotation by Michelle Graham. GO Molecular Function: helicase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PTHR10887Panther DNA2/NAM7 HELICASE FAMILY JGI ISS
PTHR10887:SF26Panther MOV-10 JGI ISS
UniRef100_A9PJK5UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PJK5_9ROSI SoyBaseE_val: 1.00E-35ISS
UniRef100_G7JYP8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Regulator of nonsense transcripts-like protein n=1 Tax=Medicago truncatula RepID=G7JYP8_MEDTR SoyBaseE_val: 4.00E-35ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g23300 not represented in the dataset

Glyma05g23300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g23300.1   sequence type=CDS   gene model=Glyma05g23300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTCAAACGAGGGTCGCATCCCAACAACGGATGGTCCTCGGATGAAATTAGGCCAGCTGCCTCTGGGTTAGTCCTTGATGAATCTTGGCTTTGGCATCTTGACTTTGAGACTTCTACAAAGTTAGTCCCCCTATTAGGAAATGAGGACATGATAAGGCCGCAACTAAGTGGAACATCTTATTTAAATAGGACTGAGGCTACAAATGTTGCAAAGATTGTAACTACTTTCTTAAAAAGTGGTGTGGTTCCAAGTCAGATTGGTGTGATAACACCTTATGAGGGGCAAAAAACTTATATTGTGAACTATATGTCAAGAAATGGTGTTTCCAGGCAACAACTTTACAAGGAGATTGAGCTACTACATGAGGAGAAATACTACATCATTTTGTCTTGTGTTAGAAGTAATGTACATCAGGTTGGACACCTTATTCTTTGTACATGGATAAGTCCAACAACTATATGGTCCATTCCCAAGTGGTTTATAAAAATCAAGAAACATGAAGAGAAACTCTTTATCTTGCTAAACAAGCTAGACAAGTATTTTACGTGCAAGACCCTTGTGATGAAAGGTGATGGTATCCTTAGGACTTCATACAGCTCATGTTTGTCGCCAGTTTCATCATCCACCACCCTTTTCTTCTCTGTCTTCTCACGTTTATTGTTGTTAAACCCATATATATGCCTTCTTCCCTTCATCATAGTTGATTTCCTGTCTTATTCTCCAATGACACACTTTGATGGCCTGTATCTCTTTTCT

>Glyma05g23300.1   sequence type=predicted peptide   gene model=Glyma05g23300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VKRGSHPNNGWSSDEIRPAASGLVLDESWLWHLDFETSTKLVPLLGNEDMIRPQLSGTSYLNRTEATNVAKIVTTFLKSGVVPSQIGVITPYEGQKTYIVNYMSRNGVSRQQLYKEIELLHEEKYYIILSCVRSNVHQVGHLILCTWISPTTIWSIPKWFIKIKKHEEKLFILLNKLDKYFTCKTLVMKGDGILRTSYSSCLSPVSSSTTLFFSVFSRLLLLNPYICLLPFIIVDFLSYSPMTHFDGLYLFS







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo