SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma05g23056

Feature Type:gene_model
Chromosome:Gm05
Start:28538661
stop:28541733
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80380AT Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr1:30217895-30219784 FORWARD LENGTH=364 SoyBaseE_val: 7.00E-21ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008887GO-mf Annotation by Michelle Graham. GO Molecular Function: glycerate kinase activity SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
UniRef100_G7IME0UniRef Annotation by Michelle Graham. Most informative UniRef hit: D-glycerate 3-kinase n=1 Tax=Medicago truncatula RepID=G7IME0_MEDTR SoyBaseE_val: 7.00E-20ISS
UniRef100_UPI000233D762UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D762 related cluster n=1 Tax=unknown RepID=UPI000233D762 SoyBaseE_val: 1.00E-27ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g23056 not represented in the dataset

Glyma05g23056 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g23056.1   sequence type=CDS   gene model=Glyma05g23056   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTAGTAATGCTAAGAATGTTGAACAGAATGACAAAATAGAAGCTTTGGATAAATATCAGCCTGGGACTGGTTCTGATGAAGATGAAGATGCACCAAATAGTACTGCTAAGAATGGAGTCCACTTGCAAGAACATATTGATTTTCATGATGGAAGATGGAGGAGAAGAGCAATATTTGGAAATGATTGTGTAGATTCAGAAGGGGATGAGGATGGTGCTACCAGTGATGATGATATAGAATCTTCAGAAGAAGAGGAGGAAGATGGCAATGATAATCATGACACAAATGGTGTGAGCTTTTTTGTACGTGTGGTGGCAATGGAAGAAGCTGTGTTGGTGTTGGCTTTTGTGGGCAAGTTGAGAAGGCACCTTCTGCTGCTTGTTGTGGCAATGGTGCTTGTGCTATTAGTCTCTTCATTTGCTTCACCTCTCAGCGATGAAGAGAAAAACAAGAGTTTCTCTTGCATTCGTGCATGTGGGTGTCTACTGTTTCAGCTTAATGAATTGTTCCTTATGGAGTCTCAAAAGGCTAGGATTTATCATTACTATGTACCTGTCTTTCTCTGGTGTGAACAGCAGATTACTGAGCATCAGTCGAAGTTTAAAGATGGAGAAGATATACCTCCTTTAGTGTTCCTAAGAGGTTCAGGCTTGCAAAGGACACAAATTTGGACAAAGGCACTTGAATAA

>Glyma05g23056.1   sequence type=predicted peptide   gene model=Glyma05g23056   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSNAKNVEQNDKIEALDKYQPGTGSDEDEDAPNSTAKNGVHLQEHIDFHDGRWRRRAIFGNDCVDSEGDEDGATSDDDIESSEEEEEDGNDNHDTNGVSFFVRVVAMEEAVLVLAFVGKLRRHLLLLVVAMVLVLLVSSFASPLSDEEKNKSFSCIRACGCLLFQLNELFLMESQKARIYHYYVPVFLWCEQQITEHQSKFKDGEDIPPLVFLRGSGLQRTQIWTKALE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo