SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g22760

Feature Type:gene_model
Chromosome:Gm05
Start:28155481
stop:28156476
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g22760
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G22880AT Annotation by Michelle Graham. TAIR10: VQ motif-containing protein | chr2:9741119-9741463 REVERSE LENGTH=114 SoyBaseE_val: 7.00E-11ISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05678PFAM VQ motif JGI ISS
UniRef100_D7LE53UniRef Annotation by Michelle Graham. Most informative UniRef hit: VQ motif-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LE53_ARALL SoyBaseE_val: 3.00E-09ISS
UniRef100_I1K2F7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2F7_SOYBN SoyBaseE_val: 6.00E-135ISS

Proteins Associated with Glyma05g22760
LocusGene SymbolProtein Name
VQ15 VQ motif containing protein gene 15

Expression Patterns of Glyma05g22760
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g22760
ParalogEvidenceComments
Glyma17g17210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g22760 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g107500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g22760
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g22760
>Glyma05g22760.1   sequence type=CDS   gene model=Glyma05g22760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGCCTATTCTAGTTCTTATTCCTCGTCATCCAATTCTTCATACTTGACCCAAAACAACCATGAGGACTCAAAAGGGTACGTGAAACAGCAAGTGTACCCTCTTCAAAATCACAATTCGTGGCTCCGTTCCGTGAGAAAGACACCAGCAAAGCCGTGGAAGAAGGCACCAGTGGCACCAATGCCACCAACACCGATCAAAGTTTACAAAGTGGACGCTATAAACTTCCGTGACGTGGTTCAGCAGCTCACAGGTGCACCCGAGCACGAGTCCCAGCAGCAGCATCTCCAAATCAAAATCGCACGTGCTGAATCTGCTGATGCTCCTAATGTGCCACCGAAGCAAAACCAATCAGGCGGAGACACGTGCGGTAAATGGTACCAGGAGTTTCTCTTAGGAATGAATTCTCCGGAGACTAATACTAATAATGATGGAGCAATGGCACCGGGTTTTCTAGGAATGAATTTGCTCTCACCAAATTCGTATAGTAATTTCTGTTTCTTTCCTCCTTTGAGCCCAAGCGGTGTCACCAGTTTGGAACCAGGGAAGGTTCTCTAG
Predicted protein sequences of Glyma05g22760
>Glyma05g22760.1   sequence type=predicted peptide   gene model=Glyma05g22760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAYSSSYSSSSNSSYLTQNNHEDSKGYVKQQVYPLQNHNSWLRSVRKTPAKPWKKAPVAPMPPTPIKVYKVDAINFRDVVQQLTGAPEHESQQQHLQIKIARAESADAPNVPPKQNQSGGDTCGKWYQEFLLGMNSPETNTNNDGAMAPGFLGMNLLSPNSYSNFCFFPPLSPSGVTSLEPGKVL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo