SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g22730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g22730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g22730

Feature Type:gene_model
Chromosome:Gm05
Start:28074718
stop:28077566
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G36990AT Annotation by Michelle Graham. TAIR10: RNApolymerase sigma-subunit F | chr2:15537502-15540016 REVERSE LENGTH=547 SoyBaseE_val: 5.00E-116ISS
GO:0006352GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, initiation SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0071482GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to light stimulus SoyBaseN/AISS
GO:0071483GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to blue light SoyBaseN/AISS
GO:0090351GO-bp Annotation by Michelle Graham. GO Biological Process: seedling development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0003899GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016987GO-mf Annotation by Michelle Graham. GO Molecular Function: sigma factor activity SoyBaseN/AISS
PF04539PFAM Sigma-70 region 3 JGI ISS
PF04542PFAM Sigma-70 region 2 JGI ISS
UniRef100_G7L3V2UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA polymerase sigma factor rpoD n=1 Tax=Medicago truncatula RepID=G7L3V2_MEDTR SoyBaseE_val: 2.00E-135ISS
UniRef100_I1K2F4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1K2F4_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g22730 not represented in the dataset

Glyma05g22730 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g22730.1   sequence type=CDS   gene model=Glyma05g22730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTGAGTCTGGCCTCTACTAGCTTGGCTGATCCTTCAATTGGAAGAAATAAAACTGTGAGGTCAACACGGCTTCTAGAGAGACGATCAAAACAAAGAAAAGTACCTAAGTCGAAAGTTATAGACGATGAAACCTACCTTGCAAGAAAGGATGATGCACAAGAAAAGCTACGTGCAGAAAAGAAGAAAAATGAAGAACATGATCAAGATGATCCCCTGCGCTTGTTCTTGTGGGGTCCCGAAACAAAACAACTTTTGACACTTGAACAAGAATCTCAATTGATATCTCAGATACAGGACTTATTGAGATTGGAAGAAGTGAAGACCAATCTTCAATCTCAATTTGGAAGGGAACCAACTATGGCTGAATGGGCAGAGGGTGCAGGACTTAATTGTCGATTGCTGCAATCACAACTTCATTCTGGTATCAGAAGCAGAGAAAAGCTTATTCAAGCAAATTTGCGCATGGTAGTCCATGTTGCCAAAAGTTATCAGGGGCGTGGTCTCAGCCTTCAGGACTTACTACAAGAGGGAAGTATGGGTCTTATGAAGAGTGTTGAAAAATTCAATCCCCTAGCCGGTAGTCGATTTGGTAATTATGCATTCTGGTGGATAAGGCAAGCAATAAGGAAGGCAGTGTTTCGACATTCCAGGACAATCCGTCTACCTATAAATTTAGAGAAGGTATTTATCCTATTGGGCAAGGTAATAGAGGCTAAGAAATTGTACATTCAGGAAGGAAACCTTCACCCAACTAAAGAAGAATTAGCAAGAAGGGTAGGAGTTACTGTAGAAAAGATTGACAAATTACTATTTTCTGCAAGAATTCCAATTTCAATGCAGCAAACTGTGTGGGCTGACCAAAATACAACTTTCCAGTTTGGTGTTAGCCAAAAACCTTCTTTGTATTTTAACGCCTCCAATCACGTGGCCTACACATGA

>Glyma05g22730.1   sequence type=predicted peptide   gene model=Glyma05g22730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LSLASTSLADPSIGRNKTVRSTRLLERRSKQRKVPKSKVIDDETYLARKDDAQEKLRAEKKKNEEHDQDDPLRLFLWGPETKQLLTLEQESQLISQIQDLLRLEEVKTNLQSQFGREPTMAEWAEGAGLNCRLLQSQLHSGIRSREKLIQANLRMVVHVAKSYQGRGLSLQDLLQEGSMGLMKSVEKFNPLAGSRFGNYAFWWIRQAIRKAVFRHSRTIRLPINLEKVFILLGKVIEAKKLYIQEGNLHPTKEELARRVGVTVEKIDKLLFSARIPISMQQTVWADQNTTFQFGVSQKPSLYFNASNHVAYT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo