SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g22510

Feature Type:gene_model
Chromosome:Gm05
Start:27774571
stop:27779310
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g22510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G67590AT Annotation by Michelle Graham. TAIR10: NADH-ubiquinone oxidoreductase-related | chr5:26958073-26959356 FORWARD LENGTH=154 SoyBaseE_val: 3.00E-75ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009631GO-bp Annotation by Michelle Graham. GO Biological Process: cold acclimation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0022900GO-bp Annotation by Michelle Graham. GO Biological Process: electron transport chain SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0005747GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I SoyBaseN/AISS
GO:0008137GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity SoyBaseN/AISS
GO:0016651GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H SoyBaseN/AISS
GO:0050897GO-mf Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding SoyBaseN/AISS
KOG3389 KOG NADH:ubiquinone oxidoreductase, NDUFS4/18 kDa subunit JGI ISS
PTHR12219Panther NADH-UBIQUINONE OXIDOREDUCTASE JGI ISS
PTHR12219:SF8Panther NADH-UBIQUINONE OXIDOREDUCTASE 18 KD-LIKE SUBUNIT JGI ISS
PF04800PFAM ETC complex I subunit conserved region JGI ISS
UniRef100_C6T2L5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2L5_SOYBN SoyBaseE_val: 8.00E-104ISS
UniRef100_G7JF62UniRef Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase n=1 Tax=Medicago truncatula RepID=G7JF62_MEDTR SoyBaseE_val: 3.00E-83ISS

Expression Patterns of Glyma05g22510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g22510
ParalogEvidenceComments
Glyma17g17360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g22510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g106100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g22510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma05g22510
>Glyma05g22510.2   sequence type=transcript   gene model=Glyma05g22510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTATTTACTGTCTTTAAAGTTTACAAATAATTGATGCATCACTAGATCCCTTATTGCTAACCATTGTAAGTTTGTAACTCAATTTGCCCTTTTGCTTTGTACCTACACTGCAATGCAGGTTGTAATTTACTCTCCTGCTAGAACTGCATCTCAACAGGGATCTGGGAAGGTTGGAAAATGGAAGATCAACTTCTTATCTACCCAAAAGTGGGAAAATCCACTGATGGGCTGGACATCCACTGGGGACCCCTACTCTCATGTTGGTGATTCTGCCTTGACTTTTGATAGTGAAGAAGCAGCAAAAGCATTTGCAGAGAAACATGGTTGGGAGTATTCGGTGAAGAAGCCCCACACACCATTGCTGAAGGTTAAATCATATGCGGACAACTTCAAATGGAAGGGACCACCCAAATCTGGTGAAGAGTGATTTGTTGGTTTGTATTCATGTTAATGCATTCCGTCTTCTGGAGTTTAACGTGCAGCAGTTTTCTCTGCATCTTTTCTTGGAAAAAAGAAAGTTTTAATGTGAATTACTGATTGGAAATAAAAGGGACTGATCTGCCATTTATTTAGTTTTCTTCTATGATGTAGATACTGCATCTGTTTATAATCGATTTGGCCTACCATCTTAACTGAACGCTGTAATGAACAATTGGTTGCAGGACAAACTGATCCAATAATAGCTGCTGACTCTGGGCAACAGTTTTTATATACTTAAGAGT
Coding sequences of Glyma05g22510
>Glyma05g22510.1   sequence type=CDS   gene model=Glyma05g22510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAATACCCTACAACGCGCCCTACGCGCCACCATGGCCCGGCGGTTCTCCACCGACGCATTGGCCGAAATTAAACGAGGCGAGATCGGAATGGTTTCTGGAATTCCTCAAGAGCACCTTCGTAGGAGGGTTGTAATTTACTCTCCTGCTAGAACTGCATCTCAACAGGGATCTGGGAAGGTTGGAAAATGGAAGATCAACTTCTTATCTACCCAAAAGTGGGAAAATCCACTGATGGGCTGGACATCCACTGGGGACCCCTACTCTCATGTTGGTGATTCTGCCTTGACTTTTGATAGTGAAGAAGCAGCAAAAGCATTTGCAGAGAAACATGGTTGGGAGTATTCGGTGAAGAAGCCCCACACACCATTGCTGAAGGTTAAATCATATGCGGACAACTTCAAATGGAAGGGACCACCCAAATCTGGTGAAGAGTGA

>Glyma05g22510.2   sequence type=CDS   gene model=Glyma05g22510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGTTGTAATTTACTCTCCTGCTAGAACTGCATCTCAACAGGGATCTGGGAAGGTTGGAAAATGGAAGATCAACTTCTTATCTACCCAAAAGTGGGAAAATCCACTGATGGGCTGGACATCCACTGGGGACCCCTACTCTCATGTTGGTGATTCTGCCTTGACTTTTGATAGTGAAGAAGCAGCAAAAGCATTTGCAGAGAAACATGGTTGGGAGTATTCGGTGAAGAAGCCCCACACACCATTGCTGAAGGTTAAATCATATGCGGACAACTTCAAATGGAAGGGACCACCCAAATCTGGTGAAGAGTGA
Predicted protein sequences of Glyma05g22510
>Glyma05g22510.1   sequence type=predicted peptide   gene model=Glyma05g22510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANTLQRALRATMARRFSTDALAEIKRGEIGMVSGIPQEHLRRRVVIYSPARTASQQGSGKVGKWKINFLSTQKWENPLMGWTSTGDPYSHVGDSALTFDSEEAAKAFAEKHGWEYSVKKPHTPLLKVKSYADNFKWKGPPKSGEE*

>Glyma05g22510.2   sequence type=predicted peptide   gene model=Glyma05g22510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQVVIYSPARTASQQGSGKVGKWKINFLSTQKWENPLMGWTSTGDPYSHVGDSALTFDSEEAAKAFAEKHGWEYSVKKPHTPLLKVKSYADNFKWKGPPKSGEE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo