|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G51590 | AT | Annotation by Michelle Graham. TAIR10: alpha-mannosidase 1 | chr1:19128315-19131406 REVERSE LENGTH=456 | SoyBase | E_val: 1.00E-49 | ISS |
| GO:0006491 | GO-bp | Annotation by Michelle Graham. GO Biological Process: N-glycan processing | SoyBase | N/A | ISS |
| GO:0009735 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus | SoyBase | N/A | ISS |
| GO:0043161 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
| GO:0043248 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasome assembly | SoyBase | N/A | ISS |
| GO:0048364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root development | SoyBase | N/A | ISS |
| GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
| GO:0051788 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to misfolded protein | SoyBase | N/A | ISS |
| GO:0005768 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endosome | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005802 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0004559 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: alpha-mannosidase activity | SoyBase | N/A | ISS |
| GO:0004571 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: mannosyl-oligosaccharide 1,2-alpha-mannosidase activity | SoyBase | N/A | ISS |
| GO:0005509 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: calcium ion binding | SoyBase | N/A | ISS |
| PTHR11742 | Panther | MANNOSYL-OLIGOSACCHARIDE ALPHA-1,2-MANNOSIDASE-RELATED | JGI | ISS | |
| PF01532 | PFAM | Glycosyl hydrolase family 47 | JGI | ISS | |
| UniRef100_B9SQ97 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Mannosyl-oligosaccharide alpha-1,2-mannosidase, putative n=1 Tax=Ricinus communis RepID=B9SQ97_RICCO | SoyBase | E_val: 1.00E-47 | ISS |
| UniRef100_UPI000233E240 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233E240 related cluster n=1 Tax=unknown RepID=UPI000233E240 | SoyBase | E_val: 4.00E-53 | ISS |
|
Glyma05g22295 not represented in the dataset |
Glyma05g22295 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g104500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g22295.1 sequence type=CDS gene model=Glyma05g22295 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCATCCTATTGTTCAGCTTGCATGGACTTGTTACAATTTCTACCAATTAACACCAACTAAATTGGCAGGAGAGAACTATTACTTTCGCAATGGACATGATATGAGTGTTGGTACCTCGTGGAATATCCAAAGGCCTGAAACAATTGAGTCTCTATTCTACCTTTGGCGTTTCACTGGAAACAAAACATACCAAGAATGGGGTTGGAATATTTTCCAAGCATTTGAAAACAATTCTCGGATTGAGACAGGATATGTTGGACTCAAAGATGTAAGAAATTCATAA
>Glyma05g22295.1 sequence type=predicted peptide gene model=Glyma05g22295 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MHPIVQLAWTCYNFYQLTPTKLAGENYYFRNGHDMSVGTSWNIQRPETIESLFYLWRFTGNKTYQEWGWNIFQAFENNSRIETGYVGLKDVRNS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||