SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21921): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21921): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21921

Feature Type:gene_model
Chromosome:Gm05
Start:26788501
stop:26789705
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G02710AT Annotation by Michelle Graham. TAIR10: PAS/LOV protein B | chr2:758925-760608 REVERSE LENGTH=358 SoyBaseE_val: 5.00E-61ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0023014GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction by phosphorylation SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0000155GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay sensor kinase activity SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
PTHR23244Panther KELCH REPEAT DOMAIN JGI ISS
PTHR23244:SF1Panther TWIN LOV PROTEIN 1 JGI ISS
UniRef100_D0PPG4UniRef Annotation by Michelle Graham. Most informative UniRef hit: PAS/LOV protein 1 n=2 Tax=Glycine max RepID=D0PPG4_SOYBN SoyBaseE_val: 7.00E-111ISS
UniRef100_UPI0002339A06UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339A06 related cluster n=1 Tax=unknown RepID=UPI0002339A06 SoyBaseE_val: 2.00E-153ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21921 not represented in the dataset

Glyma05g21921 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g102700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g21921.1   sequence type=CDS   gene model=Glyma05g21921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTCACTTCCTTCCAACAGCTTCACCATCACCGACCCCTCCATCCCGGGACACCCCATCGTCTTCGCCAACCCAAGCTTCCTCAAGCTCACGGGCTACTCCCTCCGCGAAGTCCTGGGCTGGCCCGCAGCCATCTTCTCGGGCCCATTAACATCCCAAAAATTTGTCATTTTGCTCAACTACCACAGAGATGGTATGCCGTTTTGGATGCTTTTTTGTGTTTCCCCTATTTTCAGTAGCGACGGTGGCGCTGTCGTGCACTTTATTGTTGTACAGGGATTTCGGGTTCGGGTGCTATCGGAAGGAAGTGTGCGTGGATTCGTTGGCGGAGATGATCGCATTTGTTCATTGGAGCAATTGCTCGAACCTGATGTTAGAGAATTGGAGAGAGAAGAGTCGTGTGAGGCGAGTGATGATGAGAAGCGAAGTGTTGTTACTGCCATGGACTGTATATTTTCTGTGCTAACCCATTACGGTGAGGCCACAGGGAGATTGGTGTGTAGAAAGAGGTCCAGCATTCCTGACGTGGGTCTTTTAAGCACATCCTTGATTATTTCTCTTGGTAGAATCAAACAAAGCTTTGTATTAACTAATCCGCATTTACCAGACATGCCTACTGTTTATGCTAGTGATACCTTGTTGAATTTGACAGGTTTTAAAGTCGTTACCTTATATAAATTAGATCAAGTTCAAATGAACTTATTAATATTCTCCCATAGTTCATAG

>Glyma05g21921.1   sequence type=predicted peptide   gene model=Glyma05g21921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSLPSNSFTITDPSIPGHPIVFANPSFLKLTGYSLREVLGWPAAIFSGPLTSQKFVILLNYHRDGMPFWMLFCVSPIFSSDGGAVVHFIVVQGFRVRVLSEGSVRGFVGGDDRICSLEQLLEPDVRELEREESCEASDDEKRSVVTAMDCIFSVLTHYGEATGRLVCRKRSSIPDVGLLSTSLIISLGRIKQSFVLTNPHLPDMPTVYASDTLLNLTGFKVVTLYKLDQVQMNLLIFSHSS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo