Glyma05g21921 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21921): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21921): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21921

Feature Type:	gene_model
Chromosome:	Gm05
Start:	26788501
stop:	26789705
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g21921

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G02710	AT	Annotation by Michelle Graham. TAIR10: PAS/LOV protein B \| chr2:758925-760608 REVERSE LENGTH=358	SoyBase	E_val: 5.00E-61	ISS
GO:0000160	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0010155	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of proton transport	SoyBase	N/A	ISS
GO:0023014	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction by phosphorylation	SoyBase	N/A	ISS
GO:0046777	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0000155	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphorelay sensor kinase activity	SoyBase	N/A	ISS
GO:0004871	GO-mf	Annotation by Michelle Graham. GO Molecular Function: signal transducer activity	SoyBase	N/A	ISS
PTHR23244	Panther	KELCH REPEAT DOMAIN	JGI		ISS
PTHR23244:SF1	Panther	TWIN LOV PROTEIN 1	JGI		ISS
UniRef100_D0PPG4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: PAS/LOV protein 1 n=2 Tax=Glycine max RepID=D0PPG4_SOYBN	SoyBase	E_val: 7.00E-111	ISS
UniRef100_UPI0002339A06	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339A06 related cluster n=1 Tax=unknown RepID=UPI0002339A06	SoyBase	E_val: 2.00E-153	ISS

Expression Patterns of Glyma05g21921

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21921 not represented in the dataset	Glyma05g21921 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g21921 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g102700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g21921

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g21921

Limit To All Plant Sequences

>Glyma05g21921.1   sequence type=CDS   gene model=Glyma05g21921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTCACTTCCTTCCAACAGCTTCACCATCACCGACCCCTCCATCCCGGGACACCCCATCGTCTTCGCCAACCCAAGCTTCCTCAAGCTCACGGGCTACTCCCTCCGCGAAGTCCTGGGCTGGCCCGCAGCCATCTTCTCGGGCCCATTAACATCCCAAAAATTTGTCATTTTGCTCAACTACCACAGAGATGGTATGCCGTTTTGGATGCTTTTTTGTGTTTCCCCTATTTTCAGTAGCGACGGTGGCGCTGTCGTGCACTTTATTGTTGTACAGGGATTTCGGGTTCGGGTGCTATCGGAAGGAAGTGTGCGTGGATTCGTTGGCGGAGATGATCGCATTTGTTCATTGGAGCAATTGCTCGAACCTGATGTTAGAGAATTGGAGAGAGAAGAGTCGTGTGAGGCGAGTGATGATGAGAAGCGAAGTGTTGTTACTGCCATGGACTGTATATTTTCTGTGCTAACCCATTACGGTGAGGCCACAGGGAGATTGGTGTGTAGAAAGAGGTCCAGCATTCCTGACGTGGGTCTTTTAAGCACATCCTTGATTATTTCTCTTGGTAGAATCAAACAAAGCTTTGTATTAACTAATCCGCATTTACCAGACATGCCTACTGTTTATGCTAGTGATACCTTGTTGAATTTGACAGGTTTTAAAGTCGTTACCTTATATAAATTAGATCAAGTTCAAATGAACTTATTAATATTCTCCCATAGTTCATAG

Predicted protein sequences of Glyma05g21921

Limit To All Plant Sequences

>Glyma05g21921.1   sequence type=predicted peptide   gene model=Glyma05g21921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSLPSNSFTITDPSIPGHPIVFANPSFLKLTGYSLREVLGWPAAIFSGPLTSQKFVILLNYHRDGMPFWMLFCVSPIFSSDGGAVVHFIVVQGFRVRVLSEGSVRGFVGGDDRICSLEQLLEPDVRELEREESCEASDDEKRSVVTAMDCIFSVLTHYGEATGRLVCRKRSSIPDVGLLSTSLIISLGRIKQSFVLTNPHLPDMPTVYASDTLLNLTGFKVVTLYKLDQVQMNLLIFSHSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain