SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G32880 | AT | Annotation by Michelle Graham. TAIR10: homeobox gene 8 | chr4:15863587-15867822 REVERSE LENGTH=833 | SoyBase | E_val: 1.00E-124 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0007062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion | SoyBase | N/A | ISS |
| GO:0007155 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell adhesion | SoyBase | N/A | ISS |
| GO:0008284 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation | SoyBase | N/A | ISS |
| GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009855 | GO-bp | Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry | SoyBase | N/A | ISS |
| GO:0009880 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification | SoyBase | N/A | ISS |
| GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
| GO:0009888 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tissue development | SoyBase | N/A | ISS |
| GO:0009944 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis | SoyBase | N/A | ISS |
| GO:0010014 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem initiation | SoyBase | N/A | ISS |
| GO:0010067 | GO-bp | Annotation by Michelle Graham. GO Biological Process: procambium histogenesis | SoyBase | N/A | ISS |
| GO:0010072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification | SoyBase | N/A | ISS |
| GO:0010089 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylem development | SoyBase | N/A | ISS |
| GO:0010090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0010431 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed maturation | SoyBase | N/A | ISS |
| GO:0010638 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization | SoyBase | N/A | ISS |
| GO:0016049 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell growth | SoyBase | N/A | ISS |
| GO:0033044 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization | SoyBase | N/A | ISS |
| GO:0042546 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis | SoyBase | N/A | ISS |
| GO:0044036 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process | SoyBase | N/A | ISS |
| GO:0045010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin nucleation | SoyBase | N/A | ISS |
| GO:0045595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation | SoyBase | N/A | ISS |
| GO:0045597 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of cell differentiation | SoyBase | N/A | ISS |
| GO:0048589 | GO-bp | Annotation by Michelle Graham. GO Biological Process: developmental growth | SoyBase | N/A | ISS |
| GO:0048765 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation | SoyBase | N/A | ISS |
| GO:0051301 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell division | SoyBase | N/A | ISS |
| GO:0071555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall organization | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0043565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding | SoyBase | N/A | ISS |
| PF01852 | PFAM | START domain | JGI | ISS | |
| UniRef100_A8E664 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Class III HD-Zip protein CNA2 (Fragment) n=1 Tax=Medicago truncatula RepID=A8E664_MEDTR | SoyBase | E_val: 9.00E-138 | ISS |
| UniRef100_I1KGK1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KGK1_SOYBN | SoyBase | E_val: 2.33E-156 | ISS |
|
Glyma05g21726 not represented in the dataset |
Glyma05g21726 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g101500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g21726.1 sequence type=CDS gene model=Glyma05g21726 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTATACAATAAAGACACAAATTGTGAATCGGTTGTGACGAGAGGTCAGCAGCACAATTTGATAACTCAACATCCCCCACTGGATGCAAGTCCTGCATGGCTTTTGTCCATTGCAGAAGAGACTTTAGCAGAATTTCTTTCTAAGGCTACTGGGACTGCTGTTGAGTGGGTCCAAATGCATGGAATGAAGCCTGGTCCGGATTCCATTGGAATCGTTGCTATTTCTCATGGTTGCACAGGTGTGGCAGCTAGAGCCTGTGGTCTAGTGGGACTAGAACTCACTAGGGTTGCAGAAATCCTCAAAGATCAGCCTTTGTGGTTTCACGATTGCCGAGCTGTTGATGTTCTCAATGTGCTCTCCACAACAAATGGTGGAACCATTGAGATACTTTATATGCAGAGGTCTCTTAAAAATACTCAAAATGGTCCAAGCATGCCTCCCGTGAAGCATTTTGTTAGAGCTGAGATGCTGCCTAGTGGGTACCTGATCAGACCTTGTGAAGGAGGTGGTTCCATCATCCACATTGTTGATCATATGGATTTAAAGCCATGGAGTGTGCCAGAGGTGCTACGTCCATTGTACGAATCATCAACAGTACTGGCTCAGAAGACAACTATGGCAGCCCTACGTCATCTAAGGCAGATTTCACATGAAGTTTCTCAGTCCAACGTCACTGCGTGGGGTAGACGACCGACTGCACTATGA
>Glyma05g21726.1 sequence type=predicted peptide gene model=Glyma05g21726 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVYNKDTNCESVVTRGQQHNLITQHPPLDASPAWLLSIAEETLAEFLSKATGTAVEWVQMHGMKPGPDSIGIVAISHGCTGVAARACGLVGLELTRVAEILKDQPLWFHDCRAVDVLNVLSTTNGGTIEILYMQRSLKNTQNGPSMPPVKHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLKPWSVPEVLRPLYESSTVLAQKTTMAALRHLRQISHEVSQSNVTAWGRRPTAL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
