SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21726): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21726): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21726

Feature Type:gene_model
Chromosome:Gm05
Start:26595908
stop:26602630
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G32880AT Annotation by Michelle Graham. TAIR10: homeobox gene 8 | chr4:15863587-15867822 REVERSE LENGTH=833 SoyBaseE_val: 1.00E-124ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007155GO-bp Annotation by Michelle Graham. GO Biological Process: cell adhesion SoyBaseN/AISS
GO:0008284GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009880GO-bp Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009888GO-bp Annotation by Michelle Graham. GO Biological Process: tissue development SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010067GO-bp Annotation by Michelle Graham. GO Biological Process: procambium histogenesis SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0010638GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042546GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis SoyBaseN/AISS
GO:0044036GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process SoyBaseN/AISS
GO:0045010GO-bp Annotation by Michelle Graham. GO Biological Process: actin nucleation SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0045597GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell differentiation SoyBaseN/AISS
GO:0048589GO-bp Annotation by Michelle Graham. GO Biological Process: developmental growth SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF01852PFAM START domain JGI ISS
UniRef100_A8E664UniRef Annotation by Michelle Graham. Most informative UniRef hit: Class III HD-Zip protein CNA2 (Fragment) n=1 Tax=Medicago truncatula RepID=A8E664_MEDTR SoyBaseE_val: 9.00E-138ISS
UniRef100_I1KGK1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KGK1_SOYBN SoyBaseE_val: 2.33E-156ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21726 not represented in the dataset

Glyma05g21726 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g101500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g21726.1   sequence type=CDS   gene model=Glyma05g21726   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTATACAATAAAGACACAAATTGTGAATCGGTTGTGACGAGAGGTCAGCAGCACAATTTGATAACTCAACATCCCCCACTGGATGCAAGTCCTGCATGGCTTTTGTCCATTGCAGAAGAGACTTTAGCAGAATTTCTTTCTAAGGCTACTGGGACTGCTGTTGAGTGGGTCCAAATGCATGGAATGAAGCCTGGTCCGGATTCCATTGGAATCGTTGCTATTTCTCATGGTTGCACAGGTGTGGCAGCTAGAGCCTGTGGTCTAGTGGGACTAGAACTCACTAGGGTTGCAGAAATCCTCAAAGATCAGCCTTTGTGGTTTCACGATTGCCGAGCTGTTGATGTTCTCAATGTGCTCTCCACAACAAATGGTGGAACCATTGAGATACTTTATATGCAGAGGTCTCTTAAAAATACTCAAAATGGTCCAAGCATGCCTCCCGTGAAGCATTTTGTTAGAGCTGAGATGCTGCCTAGTGGGTACCTGATCAGACCTTGTGAAGGAGGTGGTTCCATCATCCACATTGTTGATCATATGGATTTAAAGCCATGGAGTGTGCCAGAGGTGCTACGTCCATTGTACGAATCATCAACAGTACTGGCTCAGAAGACAACTATGGCAGCCCTACGTCATCTAAGGCAGATTTCACATGAAGTTTCTCAGTCCAACGTCACTGCGTGGGGTAGACGACCGACTGCACTATGA

>Glyma05g21726.1   sequence type=predicted peptide   gene model=Glyma05g21726   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVYNKDTNCESVVTRGQQHNLITQHPPLDASPAWLLSIAEETLAEFLSKATGTAVEWVQMHGMKPGPDSIGIVAISHGCTGVAARACGLVGLELTRVAEILKDQPLWFHDCRAVDVLNVLSTTNGGTIEILYMQRSLKNTQNGPSMPPVKHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLKPWSVPEVLRPLYESSTVLAQKTTMAALRHLRQISHEVSQSNVTAWGRRPTAL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo