SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21600

Feature Type:gene_model
Chromosome:Gm05
Start:26315859
stop:26316669
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04110AT Annotation by Michelle Graham. TAIR10: Subtilase family protein | chr1:1061457-1063784 REVERSE LENGTH=775 SoyBaseE_val: 1.00E-58ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0010103GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis SoyBaseN/AISS
GO:0042127GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation SoyBaseN/AISS
GO:0043086GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of catalytic activity SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0009897GO-cc Annotation by Michelle Graham. GO Cellular Compartment: external side of plasma membrane SoyBaseN/AISS
GO:0004252GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
PTHR10795Panther SUBTILISIN/KEXIN-RELATED SERINE PROTEASE JGI ISS
PTHR10795:SF17Panther gb def: possible protease [sinorhizobium meliloti] JGI ISS
PF00082PFAM Subtilase family JGI ISS
UniRef100_A9QY38UniRef Annotation by Michelle Graham. Most informative UniRef hit: Subtilase n=1 Tax=Lotus japonicus RepID=A9QY38_LOTJA SoyBaseE_val: 4.00E-123ISS
UniRef100_I1K295UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1K295_SOYBN SoyBaseE_val: 2.00E-166ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21600 not represented in the dataset

Glyma05g21600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g100600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g21600.2   sequence type=CDS   gene model=Glyma05g21600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CCTGTTGTTACATCCTTCTCTTCAAGAGTTCCCAACTTGCCAAGTCCTGCTATATTGAAACCAGACATCATACAACCAGGTGTGAACATCCTAGCTACTTGGCCATTCCACCTGAATAACAGTACCGATTCAAAATCCACTTTCAAAATTATGTCTGGCACATCAATGTCATGCTCACATCTTAGTGGCGTAGCTGCTTTGCTCAAAAGCTCTCATCGTCATTGGTCACCAGCCGCTATAAAATCTTCCATAATGACTTTTGTAGACTTAATCAATCTTGAACAAAAACTCATTGTTGATGAAACACTTCACCCTGTAGATATCTTTACAATAGGTTCTGTTTATGATACTGAACCTGATGATTATATACCTTATCTGTGTGGTCTAGGCTACAGCGATACCCAAGTTGGGATCATTGCACACAAAACAATTAAGTGCTCTAAGATTTCAATCATTCCCAAAGGAGAGCTCAACTATCCCTCATTTTCTGTTGTGCTTGGTTCCCCACAAACATTCACAAGGACTGTGAAAAATGTGGGTGAGGCTAACTCATCTTATGCTGTCATGGTTAATCTACCAGAAGGGGTTGATATCAAGGTCCAACCAAATAAACTTTACTTTTCAAAAGCAAACCAGAAAGAGACATATTCAGTGACATTCAGCTGTATAGAAATAGGTAATGAAACTTCAACATATGTTCAAGGGTTTTTACAATGGGTCTCTGCCAAACACACTGTAAGGAGCCCTATCTTGGTCAACTTTGCATAA

>Glyma05g21600.2   sequence type=predicted peptide   gene model=Glyma05g21600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
PVVTSFSSRVPNLPSPAILKPDIIQPGVNILATWPFHLNNSTDSKSTFKIMSGTSMSCSHLSGVAALLKSSHRHWSPAAIKSSIMTFVDLINLEQKLIVDETLHPVDIFTIGSVYDTEPDDYIPYLCGLGYSDTQVGIIAHKTIKCSKISIIPKGELNYPSFSVVLGSPQTFTRTVKNVGEANSSYAVMVNLPEGVDIKVQPNKLYFSKANQKETYSVTFSCIEIGNETSTYVQGFLQWVSAKHTVRSPILVNFA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo