SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21531

Feature Type:gene_model
Chromosome:Gm05
Start:26166489
stop:26166994
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g21531
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G27170AT Annotation by Michelle Graham. TAIR10: Structural maintenance of chromosomes (SMC) family protein | chr2:11609319-11617064 REVERSE LENGTH=1204 SoyBaseE_val: 2.00E-13ISS
GO:0007059GO-bp Annotation by Michelle Graham. GO Biological Process: chromosome segregation SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0000785GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chromatin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005819GO-cc Annotation by Michelle Graham. GO Cellular Compartment: spindle SoyBaseN/AISS
GO:0008278GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cohesin complex SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016363GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear matrix SoyBaseN/AISS
GO:0003682GO-mf Annotation by Michelle Graham. GO Molecular Function: chromatin binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
UniRef100_B9HQG8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Condensin complex components subunit n=1 Tax=Populus trichocarpa RepID=B9HQG8_POPTR SoyBaseE_val: 1.00E-19ISS
UniRef100_UPI000233C117UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C117 related cluster n=1 Tax=unknown RepID=UPI000233C117 SoyBaseE_val: 6.00E-31ISS

Expression Patterns of Glyma05g21531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21531 not represented in the dataset
Glyma05g21531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g21531 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma05g21531
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g21531
>Glyma05g21531.1   sequence type=CDS   gene model=Glyma05g21531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CGTAAATTAGAAATTACTACTTTGGAATCTGTCATTGCTCAGTCACATGAAGGGCTTAATCGTTACAAAGAAGAGAGAGACAAGTTACATGGGGAGAGAAAGTCCCTATGGGGCAAAGAGAATAAACTTACTGCTGAAATTGATAAGCTGAGAGCTGAAGTTGAGAAGGCTGAAAAGAGTCTTGATCATCATGCAATTCCTGGTGTGAGTAACCCCTCTTTCTAA
Predicted protein sequences of Glyma05g21531
>Glyma05g21531.1   sequence type=predicted peptide   gene model=Glyma05g21531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RKLEITTLESVIAQSHEGLNRYKEERDKLHGERKSLWGKENKLTAEIDKLRAEVEKAEKSLDHHAIPGVSNPSF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo