SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21496): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21496): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21496

Feature Type:gene_model
Chromosome:Gm05
Start:26163913
stop:26164526
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G05820AT Annotation by Michelle Graham. TAIR10: Nucleotide-sugar transporter family protein | chr5:1752106-1753857 REVERSE LENGTH=309 SoyBaseE_val: 1.00E-71ISS
GO:0006863GO-bp Annotation by Michelle Graham. GO Biological Process: purine nucleobase transport SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008514GO-mf Annotation by Michelle Graham. GO Molecular Function: organic anion transmembrane transporter activity SoyBaseN/AISS
PTHR11132Panther SOLUTE CARRIER FAMILY 35 JGI ISS
UniRef100_G7JAM9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Solute carrier family 35 member E4 n=1 Tax=Medicago truncatula RepID=G7JAM9_MEDTR SoyBaseE_val: 7.00E-72ISS
UniRef100_UPI000233DC6EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DC6E related cluster n=1 Tax=unknown RepID=UPI000233DC6E SoyBaseE_val: 1.00E-78ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21496 not represented in the dataset

Glyma05g21496 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g100200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g21496.1   sequence type=CDS   gene model=Glyma05g21496   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCCACATGAGTTACGTCGCCATAGCATGGATGAAGGTCGTGCCTTTGCAGACCCTTCGATCCAGGGTGCAGTTCTTCAAGATCTCTGCCCTCAGCCTCGTTTTCTGCGTCTCCGTTGTCTTCGGGAATATCTCTCTCTGCTACCTCCCCATGTCGTTTAACCAAGCCATTGGCGCCACCATGCCCTTCTTCATTGCTGTTTTTGCCTACCTTATGACGCTCAAGAGGGAGGCTGGGCTCACTTACCTCACGCTTGTTCCTGTTGTTACTGGAGTCATCATTGCAAGTGGGGGGGAACCGAGTTTTCATCTGTTTGGATTTATTATATGTGTTGCGGCTACGGCTGCAAGGGCTTTTAAATCAGTGCTACAAGGGATATATGACTTCATGTCAATTTGTTCTATCAGCATAGCATTATATGTGTTGTAG

>Glyma05g21496.1   sequence type=predicted peptide   gene model=Glyma05g21496   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCHMSYVAIAWMKVVPLQTLRSRVQFFKISALSLVFCVSVVFGNISLCYLPMSFNQAIGATMPFFIAVFAYLMTLKREAGLTYLTLVPVVTGVIIASGGEPSFHLFGFIICVAATAARAFKSVLQGIYDFMSICSISIALYVL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo