|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G05820 | AT | Annotation by Michelle Graham. TAIR10: Nucleotide-sugar transporter family protein | chr5:1752106-1753857 REVERSE LENGTH=309 | SoyBase | E_val: 1.00E-71 | ISS |
| GO:0006863 | GO-bp | Annotation by Michelle Graham. GO Biological Process: purine nucleobase transport | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0008514 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: organic anion transmembrane transporter activity | SoyBase | N/A | ISS |
| PTHR11132 | Panther | SOLUTE CARRIER FAMILY 35 | JGI | ISS | |
| UniRef100_G7JAM9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Solute carrier family 35 member E4 n=1 Tax=Medicago truncatula RepID=G7JAM9_MEDTR | SoyBase | E_val: 7.00E-72 | ISS |
| UniRef100_UPI000233DC6E | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233DC6E related cluster n=1 Tax=unknown RepID=UPI000233DC6E | SoyBase | E_val: 1.00E-78 | ISS |
|
Glyma05g21496 not represented in the dataset |
Glyma05g21496 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g100200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g21496.1 sequence type=CDS gene model=Glyma05g21496 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTGCCACATGAGTTACGTCGCCATAGCATGGATGAAGGTCGTGCCTTTGCAGACCCTTCGATCCAGGGTGCAGTTCTTCAAGATCTCTGCCCTCAGCCTCGTTTTCTGCGTCTCCGTTGTCTTCGGGAATATCTCTCTCTGCTACCTCCCCATGTCGTTTAACCAAGCCATTGGCGCCACCATGCCCTTCTTCATTGCTGTTTTTGCCTACCTTATGACGCTCAAGAGGGAGGCTGGGCTCACTTACCTCACGCTTGTTCCTGTTGTTACTGGAGTCATCATTGCAAGTGGGGGGGAACCGAGTTTTCATCTGTTTGGATTTATTATATGTGTTGCGGCTACGGCTGCAAGGGCTTTTAAATCAGTGCTACAAGGGATATATGACTTCATGTCAATTTGTTCTATCAGCATAGCATTATATGTGTTGTAG
>Glyma05g21496.1 sequence type=predicted peptide gene model=Glyma05g21496 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MCHMSYVAIAWMKVVPLQTLRSRVQFFKISALSLVFCVSVVFGNISLCYLPMSFNQAIGATMPFFIAVFAYLMTLKREAGLTYLTLVPVVTGVIIASGGEPSFHLFGFIICVAATAARAFKSVLQGIYDFMSICSISIALYVL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||