Glyma05g21496 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21496): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21496): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21496

Feature Type:	gene_model
Chromosome:	Gm05
Start:	26163913
stop:	26164526
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g21496

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G05820	AT	Annotation by Michelle Graham. TAIR10: Nucleotide-sugar transporter family protein \| chr5:1752106-1753857 REVERSE LENGTH=309	SoyBase	E_val: 1.00E-71	ISS
GO:0006863	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine nucleobase transport	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008514	GO-mf	Annotation by Michelle Graham. GO Molecular Function: organic anion transmembrane transporter activity	SoyBase	N/A	ISS
PTHR11132	Panther	SOLUTE CARRIER FAMILY 35	JGI		ISS
UniRef100_G7JAM9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Solute carrier family 35 member E4 n=1 Tax=Medicago truncatula RepID=G7JAM9_MEDTR	SoyBase	E_val: 7.00E-72	ISS
UniRef100_UPI000233DC6E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DC6E related cluster n=1 Tax=unknown RepID=UPI000233DC6E	SoyBase	E_val: 1.00E-78	ISS

Expression Patterns of Glyma05g21496

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21496 not represented in the dataset	Glyma05g21496 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g21496 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g100200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g21496

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g21496

Limit To All Plant Sequences

>Glyma05g21496.1   sequence type=CDS   gene model=Glyma05g21496   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCCACATGAGTTACGTCGCCATAGCATGGATGAAGGTCGTGCCTTTGCAGACCCTTCGATCCAGGGTGCAGTTCTTCAAGATCTCTGCCCTCAGCCTCGTTTTCTGCGTCTCCGTTGTCTTCGGGAATATCTCTCTCTGCTACCTCCCCATGTCGTTTAACCAAGCCATTGGCGCCACCATGCCCTTCTTCATTGCTGTTTTTGCCTACCTTATGACGCTCAAGAGGGAGGCTGGGCTCACTTACCTCACGCTTGTTCCTGTTGTTACTGGAGTCATCATTGCAAGTGGGGGGGAACCGAGTTTTCATCTGTTTGGATTTATTATATGTGTTGCGGCTACGGCTGCAAGGGCTTTTAAATCAGTGCTACAAGGGATATATGACTTCATGTCAATTTGTTCTATCAGCATAGCATTATATGTGTTGTAG

Predicted protein sequences of Glyma05g21496

Limit To All Plant Sequences

>Glyma05g21496.1   sequence type=predicted peptide   gene model=Glyma05g21496   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCHMSYVAIAWMKVVPLQTLRSRVQFFKISALSLVFCVSVVFGNISLCYLPMSFNQAIGATMPFFIAVFAYLMTLKREAGLTYLTLVPVVTGVIIASGGEPSFHLFGFIICVAATAARAFKSVLQGIYDFMSICSISIALYVL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain