Glyma05g21483 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21483): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21483): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21483

Feature Type:	gene_model
Chromosome:	Gm05
Start:	26163432
stop:	26163704
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g21483

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G28380	AT	Annotation by Michelle Graham. TAIR10: dsRNA-binding protein 2 \| chr2:12134098-12135915 REVERSE LENGTH=434	SoyBase	E_val: 3.00E-44	ISS
GO:0010267	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference	SoyBase	N/A	ISS
GO:0035196	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA	SoyBase	N/A	ISS
GO:0051607	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to virus	SoyBase	N/A	ISS
GO:0070919	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of siRNA involved in chromatin silencing by small RNA	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003725	GO-mf	Annotation by Michelle Graham. GO Molecular Function: double-stranded RNA binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR11207	Panther	RIBONUCLEASE III	JGI		ISS
PF00035	PFAM	Double-stranded RNA binding motif	JGI		ISS
UniRef100_G7IRT5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribonuclease n=1 Tax=Medicago truncatula RepID=G7IRT5_MEDTR	SoyBase	E_val: 1.00E-44	ISS
UniRef100_UPI000233DC6E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DC6E related cluster n=1 Tax=unknown RepID=UPI000233DC6E	SoyBase	E_val: 2.00E-45	ISS

Expression Patterns of Glyma05g21483

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21483 not represented in the dataset	Glyma05g21483 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g21483 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g100100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g21483

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g21483

Limit To All Plant Sequences

>Glyma05g21483.1   sequence type=CDS   gene model=Glyma05g21483   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACAAGAACCAGCTTCAAGAGCTAGCCCAACGGAGCTGCTTCAACCTGCCTTCATACACGTCTATTCAGGAAGGTCCCGATCATGCGCTAAGGTTCAAGGCCACTATCAACTTTAACGGCAAGATCTTCGAGACCCCTCACTACTGTTCCACTCTCCGTCAGGCCGCACACTCTGCCGCCGAAGTCGCTCTCAATTCCCTCTCCCATCGTGGCCCCTCCTATTCCCTCGTCACTAAGATTCTCATGAGTCATTGCCGCTTCTACTTCTAG

Predicted protein sequences of Glyma05g21483

Limit To All Plant Sequences

>Glyma05g21483.1   sequence type=predicted peptide   gene model=Glyma05g21483   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYKNQLQELAQRSCFNLPSYTSIQEGPDHALRFKATINFNGKIFETPHYCSTLRQAAHSAAEVALNSLSHRGPSYSLVTKILMSHCRFYF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain