SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21365

Feature Type:gene_model
Chromosome:Gm05
Start:25928509
stop:25929568
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17530AT Annotation by Michelle Graham. TAIR10: phosphoglucosamine mutase family protein | chr5:5777716-5781863 FORWARD LENGTH=614 SoyBaseE_val: 7.00E-26ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006048GO-bp Annotation by Michelle Graham. GO Biological Process: UDP-N-acetylglucosamine biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0004610GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoacetylglucosamine mutase activity SoyBaseN/AISS
GO:0016868GO-mf Annotation by Michelle Graham. GO Molecular Function: intramolecular transferase activity, phosphotransferases SoyBaseN/AISS
PTHR22573Panther PHOSPHOHEXOMUTASE FAMILY MEMBER JGI ISS
PTHR22573:SF4Panther PHOSPHOGLUCOMUTASE JGI ISS
UniRef100_G7I384UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphoglucosamine mutase n=1 Tax=Medicago truncatula RepID=G7I384_MEDTR SoyBaseE_val: 3.00E-28ISS
UniRef100_I1LD09UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LD09_SOYBN SoyBaseE_val: 1.00E-30ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21365 not represented in the dataset

Glyma05g21365 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g099400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g21365.1   sequence type=CDS   gene model=Glyma05g21365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCAAAAAATTTTCGACACTTGAGTGTCCACATAGAGCTTTCAGATCTTTTCGGGAATATGGAGAAGTTGTGCTGAAACATTTGGAGAATTCAATTGGCTCTGATCCAAGTCTACTCAAGGCTCCTGTGAACTATGAAGGGGTCCGAGTTTCTGGCTATGGTGGATGGTTCCTTCTTAGATTATCACTCCATGATCATGTACTTCCCCTTAACATTGAGGTAAAGGCCCTCATAGCTAGTCTTGGGCGGAAGTGTATAACAGAGGTGGACCTTGAATATCTTTCTATATTTACACTATATCCAAACCATGATCCCGTCTACACTGTTGGTGTATCTGACTATCACAATGACTAG

>Glyma05g21365.1   sequence type=predicted peptide   gene model=Glyma05g21365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTKKFSTLECPHRAFRSFREYGEVVLKHLENSIGSDPSLLKAPVNYEGVRVSGYGGWFLLRLSLHDHVLPLNIEVKALIASLGRKCITEVDLEYLSIFTLYPNHDPVYTVGVSDYHND*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo