Glyma05g21365 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21365

Feature Type:	gene_model
Chromosome:	Gm05
Start:	25928509
stop:	25929568
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g21365

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G17530	AT	Annotation by Michelle Graham. TAIR10: phosphoglucosamine mutase family protein \| chr5:5777716-5781863 FORWARD LENGTH=614	SoyBase	E_val: 7.00E-26	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0006048	GO-bp	Annotation by Michelle Graham. GO Biological Process: UDP-N-acetylglucosamine biosynthetic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0004610	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphoacetylglucosamine mutase activity	SoyBase	N/A	ISS
GO:0016868	GO-mf	Annotation by Michelle Graham. GO Molecular Function: intramolecular transferase activity, phosphotransferases	SoyBase	N/A	ISS
PTHR22573	Panther	PHOSPHOHEXOMUTASE FAMILY MEMBER	JGI		ISS
PTHR22573:SF4	Panther	PHOSPHOGLUCOMUTASE	JGI		ISS
UniRef100_G7I384	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phosphoglucosamine mutase n=1 Tax=Medicago truncatula RepID=G7I384_MEDTR	SoyBase	E_val: 3.00E-28	ISS
UniRef100_I1LD09	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LD09_SOYBN	SoyBase	E_val: 1.00E-30	ISS

Expression Patterns of Glyma05g21365

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21365 not represented in the dataset	Glyma05g21365 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g21365 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g099400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g21365

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g21365

Limit To All Plant Sequences

>Glyma05g21365.1   sequence type=CDS   gene model=Glyma05g21365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCAAAAAATTTTCGACACTTGAGTGTCCACATAGAGCTTTCAGATCTTTTCGGGAATATGGAGAAGTTGTGCTGAAACATTTGGAGAATTCAATTGGCTCTGATCCAAGTCTACTCAAGGCTCCTGTGAACTATGAAGGGGTCCGAGTTTCTGGCTATGGTGGATGGTTCCTTCTTAGATTATCACTCCATGATCATGTACTTCCCCTTAACATTGAGGTAAAGGCCCTCATAGCTAGTCTTGGGCGGAAGTGTATAACAGAGGTGGACCTTGAATATCTTTCTATATTTACACTATATCCAAACCATGATCCCGTCTACACTGTTGGTGTATCTGACTATCACAATGACTAG

Predicted protein sequences of Glyma05g21365

Limit To All Plant Sequences

>Glyma05g21365.1   sequence type=predicted peptide   gene model=Glyma05g21365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTKKFSTLECPHRAFRSFREYGEVVLKHLENSIGSDPSLLKAPVNYEGVRVSGYGGWFLLRLSLHDHVLPLNIEVKALIASLGRKCITEVDLEYLSIFTLYPNHDPVYTVGVSDYHND*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain