Report for Sequence Feature Glyma05g21360
Feature Type: gene_model
Chromosome: Gm05
Start: 25904882
stop: 25906033
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g21360
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G37290 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to karrikin; LOCATED IN: endomembrane system; EXPRESSED IN: cotyledon, hypocotyl, leaf; EXPRESSED DURING: LP.04 four leaves visible; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G23270.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:17549929-
SoyBase E_val: 2.00E-11 ISS
GO:0009693 GO-bp
Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process
SoyBase N/A ISS
GO:0009723 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus
SoyBase N/A ISS
GO:0080167 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to karrikin
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_B9IHA0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: ABC transporter family protein n=1 Tax=Populus trichocarpa RepID=B9IHA0_POPTR
SoyBase E_val: 2.00E-18 ISS
UniRef100_I1K285 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K285_SOYBN
SoyBase E_val: 2.00E-89 ISS
Expression Patterns of Glyma05g21360
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma05g21360
Paralog Evidence Comments
Glyma17g18230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g21360 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.05g099300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma05g21360
Coding sequences of Glyma05g21360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g21360.1 sequence type=CDS gene model=Glyma05g21360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACAAGCATGCTGAAAACTCAGGCCTTACTAGTTCTCGTGTTATTGGTGAACTTTGCTTTTTTCATGGGCTTAGAAGCCCGTCCATTAAGTATCATTGAGACGGGGAAATCAGCCACTGGAGGGGAAGAGGTGGATTTCTTTGATTGGTTAGCTCTGGGAGCAATGAAGGATTCTGGGCCAAGCCCAGGTGTGGGACACAAGTTCACCAATAGTGAAACCCTTGGTGGGATTAAGGACTCTGGTCCTAGTCCTGGAGGGAAAGGTCACCAATTTACAAACAGCGAGACACTTGGTGGAATCAAGAACTCGGGTCCTAGCGTCGGAGGAGAGGGTCACAAATTTACCAACAGTGAGACCCTTGGCGAAATTAAGGATTCGGGTCCAAGTCCTGGCCAAGGACACTAA
Predicted protein sequences of Glyma05g21360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g21360.1 sequence type=predicted peptide gene model=Glyma05g21360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTSMLKTQALLVLVLLVNFAFFMGLEARPLSIIETGKSATGGEEVDFFDWLALGAMKDSGPSPGVGHKFTNSETLGGIKDSGPSPGGKGHQFTNSETLGGIKNSGPSVGGEGHKFTNSETLGEIKDSGPSPGQGH*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
