|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG00140 | AT | Annotation by Michelle Graham. TAIR10: ATP synthase subunit C family protein | chrC:13262-13507 REVERSE LENGTH=81 | SoyBase | E_val: 1.00E-36 | ISS |
GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0015986 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport | SoyBase | N/A | ISS |
GO:0015991 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport | SoyBase | N/A | ISS |
GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
GO:0033177 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, proton-transporting domain | SoyBase | N/A | ISS |
GO:0045263 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, coupling factor F(o) | SoyBase | N/A | ISS |
GO:0015078 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity | SoyBase | N/A | ISS |
PF00137 | PFAM | ATP synthase subunit C | JGI | ISS | |
UniRef100_I1K284 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K284_SOYBN | SoyBase | E_val: 8.00E-50 | ISS |
UniRef100_Q32RK9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase subunit c, chloroplastic n=1 Tax=Zygnema circumcarinatum RepID=ATPH_ZYGCR | SoyBase | E_val: 3.00E-34 | ISS |
Glyma05g21346 not represented in the dataset |
Glyma05g21346 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g21346.1 sequence type=CDS gene model=Glyma05g21346 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACAATTCTAAGAAGATTTGACCTTCCTTTGCAATGGAATGACATAGTCCTCAACACTAGCATTGGTGACAAATACATTGTTCAACCTTGGTACCAATTTCCTTTTATTCCTGCTGGGTTGGCTATAGGGCCTGCTTCTATTGGACCTAGGGTTGGTCAAGGCACTACTGTAGGGCAAGCTGTAGAAGGGATTGCACGACAACCGGAGGCAGAGGGAAAAATACGAGGTACTTTATTGCTTAGTTTGGCTTTTATGGAAGCCTTAACAATTTATGGATTGGTTGTAGTATTAGCACTTTTATTTGCAAATCCTTTTGTTTAA
>Glyma05g21346.1 sequence type=predicted peptide gene model=Glyma05g21346 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTILRRFDLPLQWNDIVLNTSIGDKYIVQPWYQFPFIPAGLAIGPASIGPRVGQGTTVGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVVLALLFANPFV*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||