SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g21050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g21050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g21050

Feature Type:gene_model
Chromosome:Gm05
Start:25380378
stop:25381387
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g21050
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03160AT Annotation by Michelle Graham. TAIR10: homolog of mamallian P58IPK | chr5:750286-752671 FORWARD LENGTH=482 SoyBaseE_val: 3.00E-88ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005788GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum lumen SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
UniRef100_G7L2R8UniRef Annotation by Michelle Graham. Most informative UniRef hit: DnaJ homolog subfamily C member-like protein n=1 Tax=Medicago truncatula RepID=G7L2R8_MEDTR SoyBaseE_val: 3.00E-122ISS
UniRef100_UPI00023399F4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023399F4 related cluster n=1 Tax=unknown RepID=UPI00023399F4 SoyBaseE_val: 3.00E-147ISS

Expression Patterns of Glyma05g21050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g21050 not represented in the dataset
Glyma05g21050 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g21050 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g097500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g21050
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g21050
>Glyma05g21050.1   sequence type=CDS   gene model=Glyma05g21050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTGGAGTTAAAACCTGGAGATTCAGCTACAGAAAATAAGCTCTCTCAACTACTGCAGGCTCAAAGTGCTTTGGAAACAACTCAGTCCTTCTATGATTCGGGCAACTTCTCAAAATCTTTGGAATACATTGATAAAGTTGTTCTTGTTTTTTCTTCAACTTGCAATAAGGCTAAGCTTCTTAAAGTGAAAGTGTTAATTGCTGATAAAGAGTATGAGAATGCTATTGCCGAGTCTGGTTTTCTTCTTAAGGAAGATGAAAATAATTTAGAGGCATTTTTGTTACGTGGTCGTGCACATTACTATTTAGCTGATCATGATGTTGCCACGAGGCATTTTCATAAAGGTCTCCGCCTAGATCCAGAGCATAGTGAACTAAAAAAGGCATATTTTGGATTGAAAAATCTACTCAAAAAGAGTAAAAGTGCTAAAGATAATGCTAGTAAGGGTAAACTACGCATGGCAGTGGAGGAATTCAAAGCTGCACTTGCTGTTGACCCTATACATCTTGCACACAATGTACATCTTCATCTTGGCTTATGTAAAGTGCTAGTCAAGCTTGGCAGAGGAAAAGATGCCTTGGACAGTTGTAGTGAAGCTTTTAAGATTGATGAGGAGCTTGTGGAAGCTCTT
Predicted protein sequences of Glyma05g21050
>Glyma05g21050.1   sequence type=predicted peptide   gene model=Glyma05g21050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LELKPGDSATENKLSQLLQAQSALETTQSFYDSGNFSKSLEYIDKVVLVFSSTCNKAKLLKVKVLIADKEYENAIAESGFLLKEDENNLEAFLLRGRAHYYLADHDVATRHFHKGLRLDPEHSELKKAYFGLKNLLKKSKSAKDNASKGKLRMAVEEFKAALAVDPIHLAHNVHLHLGLCKVLVKLGRGKDALDSCSEAFKIDEELVEAL






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo