|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G18680 | AT | Annotation by Michelle Graham. TAIR10: Amino acid kinase family protein | chr3:6427533-6429520 FORWARD LENGTH=339 | SoyBase | E_val: 1.00E-23 | ISS |
| GO:0006221 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pyrimidine nucleotide biosynthetic process | SoyBase | N/A | ISS |
| GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
| GO:0006399 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tRNA metabolic process | SoyBase | N/A | ISS |
| GO:0008652 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009073 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process | SoyBase | N/A | ISS |
| GO:0009658 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chloroplast organization | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0016226 | GO-bp | Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly | SoyBase | N/A | ISS |
| GO:0045036 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0048481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ovule development | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009041 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: uridylate kinase activity | SoyBase | N/A | ISS |
| GO:0033862 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: UMP kinase activity | SoyBase | N/A | ISS |
| PTHR26059 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR26059:SF1 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| UniRef100_G7LD78 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Uridylate kinase n=1 Tax=Medicago truncatula RepID=G7LD78_MEDTR | SoyBase | E_val: 7.00E-25 | ISS |
| UniRef100_I1K258 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1K258_SOYBN | SoyBase | E_val: 3.00E-38 | ISS |
|
Glyma05g20400 not represented in the dataset |
Glyma05g20400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g095600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g20400.1 sequence type=CDS gene model=Glyma05g20400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGACTTGGAAGGGAAAACCGTCAAGCTGCAGATAGTGAGTATTCTCAGGAAGTTCGAGATTCCGTCCATGTCTCACTTGAGACTCTCAATGAACGAAAGTAGCAAGCCTTCATTTAAATGGCGAAGGGTTTTGCTCAAAGTTAGCGGAGAAGCACTTGCTGGAGACCACTCTCAGAACATTGACCCTAAGATAACCATGGCCATTGCAAGGGAGGTGGCAGCAGTGACACGCCTTGGCATTGAGGTGACTACAATGGATTCTTTTATTCTAATACTTTTTTGTTTCTTTTCATATTCATAG
>Glyma05g20400.1 sequence type=predicted peptide gene model=Glyma05g20400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDLEGKTVKLQIVSILRKFEIPSMSHLRLSMNESSKPSFKWRRVLLKVSGEALAGDHSQNIDPKITMAIAREVAAVTRLGIEVTTMDSFILILFCFFSYS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||