SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g20280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g20280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g20280

Feature Type:gene_model
Chromosome:Gm05
Start:24326436
stop:24338729
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g20280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G11050AT Annotation by Michelle Graham. TAIR10: ferritin 2 | chr3:3463651-3465294 FORWARD LENGTH=253 SoyBaseE_val: 1.00E-39ISS
GO:0000302GO-bp Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species SoyBaseN/AISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0006879GO-bp Annotation by Michelle Graham. GO Biological Process: cellular iron ion homeostasis SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0010039GO-bp Annotation by Michelle Graham. GO Biological Process: response to iron ion SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0055072GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion homeostasis SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0008199GO-mf Annotation by Michelle Graham. GO Molecular Function: ferric iron binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0046914GO-mf Annotation by Michelle Graham. GO Molecular Function: transition metal ion binding SoyBaseN/AISS
PTHR11431Panther FERRITIN JGI ISS
PTHR11431:SF8Panther FERRITIN LIGHT CHAIN JGI ISS
PF00210PFAM Ferritin-like domain JGI ISS
UniRef100_I1K255UniRef Annotation by Michelle Graham. Best UniRef hit: Ferritin (Fragment) n=1 Tax=Glycine max RepID=I1K255_SOYBN SoyBaseE_val: 7.00E-53ISS
UniRef100_I1K255UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ferritin (Fragment) n=1 Tax=Glycine max RepID=I1K255_SOYBN SoyBaseE_val: 7.00E-53ISS

Expression Patterns of Glyma05g20280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g20280 not represented in the dataset
Glyma05g20280 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g20280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g095400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g20280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g20280
>Glyma05g20280.1   sequence type=CDS   gene model=Glyma05g20280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTAGCAATGGAACTTGCCCTGTTGTTGGAGAAGCTGACAAATGAAAAGTTGCTTAACTTGCACAGTGTTGCCTCAAAGAGCAATGATGCGCAATTGTCAGATTTTATTGAAAGCGAGTTTTTGGGTGAACAGGTGGAAGCCATAAAAAAAATCTCTGAATACGTTGCTCAACTTAGAAGAGTTGGAAAAGGACATGGTGTGTGGCACTTTGATCAGATGCTACTCCATGAGGAAGGAGTAGCATTTCACTTCAGATTACATGAAGCCTGA
Predicted protein sequences of Glyma05g20280
>Glyma05g20280.1   sequence type=predicted peptide   gene model=Glyma05g20280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVAMELALLLEKLTNEKLLNLHSVASKSNDAQLSDFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVAFHFRLHEA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo