SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g19611

Feature Type:gene_model
Chromosome:Gm05
Start:23543118
stop:23543736
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g19611
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27160AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S21 family protein | chr3:10017531-10018854 FORWARD LENGTH=183 SoyBaseE_val: 5.00E-15ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
UniRef100_B9RBJ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Structural constituent of ribosome, putative n=1 Tax=Ricinus communis RepID=B9RBJ4_RICCO SoyBaseE_val: 1.00E-18ISS
UniRef100_I1N7I0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N7I0_SOYBN SoyBaseE_val: 2.00E-53ISS

Expression Patterns of Glyma05g19611
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g19611 not represented in the dataset
Glyma05g19611 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g19611 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g094200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g19611
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g19611
>Glyma05g19611.1   sequence type=CDS   gene model=Glyma05g19611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAACATCAGCATCAACATCTGCATCTGCGCGTGCAATTGGAATCGATAATGATTCCTCAATTAAGAGTATATTATACCCTGCACTCTCCCTTTCCAACATTCTTCACTTCAATGTGCAGATCATGGTGGGCGAGGACGAGCCCGAGGACAGAATCATCAACCGCTTTAAGAAGGAGGTCCTCAAAGCCGACGACAAGATCAAGAGGAAGGCCTGCGAAGCTTCTAGAAGGAATCGAAAGAGGAAGCCACAATCAAGAGCTTGGGCACAGAATAAACATGATTCTGAAAAGAAGAAAAAGGATGCTGCTCATGATGATATTGATGATTGGGAACTTCCACATGTAGGTATTCCGTATACTTGA
Predicted protein sequences of Glyma05g19611
>Glyma05g19611.1   sequence type=predicted peptide   gene model=Glyma05g19611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTTSASTSASARAIGIDNDSSIKSILYPALSLSNILHFNVQIMVGEDEPEDRIINRFKKEVLKADDKIKRKACEASRRNRKRKPQSRAWAQNKHDSEKKKKDAAHDDIDDWELPHVGIPYT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo